Loading...
Soek resultate vir: Druk-en grafiese toerusting
Gevind 277 maatskappyeVerkies volledige lys met betrekking tot: Druk-en grafiese toerusting
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... Lees meer »
- Sak maak masjinerie | Druk-en grafiese toerusting | Masjinerie en toerusting vir die sortering van papier |...
- Hyderabad
- Indië
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Lees meer »
- Sekuriteit produk agente | Oordrag druk | Injectiegieten, vir metale | Isolasie materiaal | Vere - vervaardiging...
- Amravati
- Indië
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Lees meer »
- Sekuriteit produk agente | Oordrag druk | Injectiegieten, vir metale | Isolasie materiaal | Vere - vervaardiging...
- Mumbai
- Indië
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Lees meer »
- Sekuriteit produk agente | Oordrag druk | Injectiegieten, vir metale | Isolasie materiaal | Vere - vervaardiging...
- Faridabad
- Indië
supplyautonomy.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... Lees meer »
- Ander klere masjinerie | Druk-en grafiese toerusting | Deurlopende cilindermachines vir kartonproductie |...
- Mumbai
- Indië
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Lees meer »
- Sekuriteit produk agente | Oordrag druk | Injectiegieten, vir metale | Isolasie materiaal | Vere - vervaardiging...
- Bardoli
- Indië
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Lees meer »
- Sekuriteit produk agente | Oordrag druk | Injectiegieten, vir metale | Isolasie materiaal | Vere - vervaardiging...
- Ahmedabad
- Indië
supplyautonomy.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... Lees meer »
- Sekuriteit produk agente | Oordrag druk | Injectiegieten, vir metale | Isolasie materiaal | Vere - vervaardiging...
- Pune
- Indië
supplyautonomy.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... Lees meer »
- Sekuriteit produk agente | Oordrag druk | Injectiegieten, vir metale | Isolasie materiaal | Vere - vervaardiging...
- Kalol
- Indië
supplyautonomy.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- Druk-en grafiese toerusting | Cilinderdrukpersen met enkele omwenteling | Cilinderdrukpersen met dubbele omwenteling |...
- Wadhwan
- Indië
supplyautonomy.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... Lees meer »
- Sakke | Natstoommachines vir tekstiel | Droogstoommachines vir tekstiel | Stoomtoepassingen onder lae druk vir tekstiel...
- New Delhi
- Indië
supplyautonomy.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... Lees meer »
- Sekuriteit produk agente | Oordrag druk | Injectiegieten, vir metale | Isolasie materiaal | Vere - vervaardiging...
- Ilkal
- Indië
supplyautonomy.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- Invoer en uitvoer van papier | Toiletpapier | Servette, sakdoeke en gezichtsdoekjes van cellulosewatten | Klam...
- Jodhpur
- Indië
supplyautonomy.com/laxmiudyog.in
- Sekuriteit produk agente | Oordrag druk | Injectiegieten, vir metale | Isolasie materiaal | Vere - vervaardiging...
- Mumbai
- Indië
supplyautonomy.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... Lees meer »
- Koppelstukken | Kogelkleppen | Vleugelkleppen | Vervoerbande van vezelcement | Vuurbestendige produkte van vezelcement...
- Howrah
- Indië
supplyautonomy.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... Lees meer »
- Druk-en grafiese toerusting | Papier verwerking masjinerie | Drukkers en bande
- Ahmedabad
- Indië
supplyautonomy.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... Lees meer »
- Rek film | Druk-en grafiese toerusting | Verpakking masjinerie
- Wenzhou
- Sjina
supplyautonomy.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... Lees meer »
- Druk-en grafiese toerusting | Papier verwerking masjinerie | Gereedskap vir die maal van metaal
- Cangzhou
- Sjina
supplyautonomy.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... Lees meer »
- Druk-en grafiese toerusting | Laser toerusting
- Shenzhen
- Sjina
supplyautonomy.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... Lees meer »
- Skoonmaak van toerusting | Druk-en grafiese toerusting
- Taixing
- Sjina
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Lees meer »
- Druk-en grafiese toerusting | Ander materiaal hantering van toerusting
- Wenzhou
- Sjina
supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Lees meer »
- Sak maak masjinerie | Druk-en grafiese toerusting
- Ruian
- Sjina
supplyautonomy.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... Lees meer »
- Sak maak masjinerie | Druk-en grafiese toerusting
- Ruian
- Sjina
supplyautonomy.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... Lees meer »
- Sak maak masjinerie | Druk-en grafiese toerusting
- Ruian
- Sjina
supplyautonomy.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... Lees meer »
- Druk-en grafiese toerusting | Papier produk maak masjinerie
- Dongguan
- Sjina
supplyautonomy.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... Lees meer »
- Sakke en sakke | Naaimasjiene | Druk-en grafiese toerusting | Verpakking masjinerie
- Wenzhou
- Sjina
supplyautonomy.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... Lees meer »
- Ander tekstiel masjinerie | Druk-en grafiese toerusting
- Ahmedabad
- Indië
supplyautonomy.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... Lees meer »
- Sak maak masjinerie | Druk-en grafiese toerusting | Verpakking masjinerie
- Vadodara
- Indië
supplyautonomy.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... Lees meer »
- Masjiene vir die afwerking van tekstiele | Druk-en grafiese toerusting | Verpakking masjinerie
- Ahmedabad
- Indië
supplyautonomy.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... Lees meer »
- Druk-en grafiese toerusting | Sement sakke | Elektriese en elektroniese toerusting
- Ahmedabad
- Indië