Loading...
Вынікі пошуку для: Медныя руды
Знойдзеныя 745 кампанііsupplyautonomy.com/merecouklimited.gb
supplyautonomy.com/mbros.tz
MBROS
Is registered mining company, and based in Dar-Es-Salaam, Tanzania. It is private owned company and producer of value added copper.
MBROS has successfully secured other high quality... Больш падрабязна »
- Медныя руды
- Dar-Es-Salaam
- Танзанія, Аб'яднаная Рэспубліка
supplyautonomy.com/metalcosarlchinaoffice.de
Metalco is a mining company in Berlin, Germany, we have our own mines in D.R. Congo, Africa. Our main products: TANTALITE COLTAN ORE Ta2O5, Cobalt Ore, Tin ore/concentrate,Copper ore/concentrate ... Больш падрабязна »
- Медныя руды
- Berlin
- Германія
supplyautonomy.com/globalmetalslimited.cm
global metals cameroon is specialized in the extraction and trading of iron ore, lead ore chrome ore,copper ore. we do export in any part of the world. our company has been in existence since 1999.... Больш падрабязна »
- Медныя руды
- Bamenda
- Камерун
supplyautonomy.com/arcinternationaltrading.za
Kankana Holdings is a Sales Distribution company based in Durban South Africa.
We specialise in forming partnerships with major and indepenedent retailers for whome we source key retail products. ... Больш падрабязна »
- Медныя руды
- Durban, Pinetown
- Паўднёва-Афрыканская Рэспубліка
supplyautonomy.com/tlholegoholdingptyltd.za
We are a south african company, well connected in africa, able to facilitate a wide variety of deals, we also act as a consulting company for businesses, presenting them with viable solutions for... Больш падрабязна »
- Медныя руды
- Pretoria
- Паўднёва-Афрыканская Рэспубліка
supplyautonomy.com/uhurushipping.za
uhuru is a customs clearing and fowarding co.we do a lot of work in to africa
a subsidery co. called Prinvee Trucking does all our transport into Africa so if any commodity is required we will... Больш падрабязна »
- Медныя руды
- Durban
- Паўднёва-Афрыканская Рэспубліка
supplyautonomy.com/tisoknventurestrading.za
Tisokn Ventures Trading is a sourcing, procurement and supply chain management consulting firm focusing primarily on International Companies looking at procuring Chrome commodities resources from... Больш падрабязна »
- Медныя руды
- Johannesburg
- Паўднёва-Афрыканская Рэспубліка
supplyautonomy.com/comercialpecemixsa.cl
Commercial company dedicated to the import and export of nutritional, honey, mineral products and wood. Our company at the comercial area it is new, born product of the necessities of the existing... Больш падрабязна »
- Медныя руды
- Santiago
- Чылі
supplyautonomy.com/affinitysa.cl
We are a Chilean copper company.
We produce copper concentrate 28/32%.
Our usually procedure is the following:
Introduction of your company
Request of prouct
Quantity
Port of... Больш падрабязна »
- Медныя руды
- Santiago
- Чылі
supplyautonomy.com/asdingenieriasa.cl
Provide Mining engineering services, Mine geology, Mine planning, Plant design, Plant operation. Ore handling, Ore concentration, Tailing dams and Environmental protection. Copper selling and... Больш падрабязна »
- Медныя руды
- Santiago
- Чылі
supplyautonomy.com/zazzyglobalresources.ng
May we introduce our organization ZAZZY GLOBAL RESOURCES LTD to You?
ZAZZY GLOBAL RESOURCES LTD is an organization which is registered with both CORPORATE AFFAIRS COMMISSION (CAC) NIGERIA EXPORT... Больш падрабязна »
- Медныя руды
- Ikeja
- Нігерыя
supplyautonomy.com/tripleinheritancegrits.ng
We are dealers / agents of different kinds of solid minerals (metals, on-metals and gemstones rough) that are abundant in Nigeria, We recently acquired our mining company; Gosello Ltd which has been... Больш падрабязна »
- Медныя руды
- Jos
- Нігерыя
supplyautonomy.com/msmtechconsulting.gb
Product: Iraqi light crude oil
Price: Below the market. Contact us for more precisions.
Contract quantity:10 million barrels total,50,000+ per day.
Contract performance duration/scheduled... Больш падрабязна »
- Медныя руды
- London
- Велікабрытанія
supplyautonomy.com/cjbennettimportexportagency.gb
From Kenya we can supply both green and roasted Arabica coffee beans, (Orgainc + Non orgainic) as well as black and green tea leaves. We buy both the coffee and tea direct from the auctions to gain... Больш падрабязна »
- Медныя руды
- Southampton
- Велікабрытанія
supplyautonomy.com/goldentransfermarketingservices.ph
Golden Transfer Marketing Services is a duly registered and licensed trading service company in the Philippines.
We are engaged in trading of scrap vessel metal and by-products (iron, aluminum,... Больш падрабязна »
- Медныя руды
- Manila
- Філіпіны
supplyautonomy.com/pakistancommoditiesinternationaltrade.pk
PAKISTAN COMMODITIES INTERNATIONAL TRADE (PCIT), have attained pinnacles of success in our domain. Owing to our passion for success and commitment to quality, we soon grew into a prominent... Больш падрабязна »
- Медныя руды
- Karachi
- Пакістан
supplyautonomy.com/taranainternational.pk
Tarana International is trading company, I Capt.Tarana Saleem owner of this company. we are ship breakers, Importers and Exporters in Pakistan. we have lot of Copper ore and Iron ore in our mines
- Медныя руды
- Karachi
- Пакістан
supplyautonomy.com/sir.cn
We are engaged in trading and investement in mienrals and energy field, the materials asre mainly used in based industries and Aerospace and relative industries, best serving for esteemed customers... Больш падрабязна »
- Медныя руды
- Pudong
- Кітай
supplyautonomy.com/sambhicresourcesfzc.ae
- Медныя руды
- Dubai
- Аб'яднаныя Арабскія Эміраты
supplyautonomy.com/milandonyaietejarat.ir
- Медныя руды
- Tehran
- Іран, Ісламская Рэспубліка
supplyautonomy.com/sstco1.ir
We are SST Co. As technical and trading Co in Iran. We could supply Iron ore, copper sulphate, zinc sulphate from Iran with the best quality and price.
We will send you the detail spesifications... Больш падрабязна »
- Медныя руды
- Mashad
- Іран, Ісламская Рэспубліка
supplyautonomy.com/weipnekretnine.hr
- Медныя руды
- Varazdin
- Харватыя
supplyautonomy.com/nyenterprises.sd
We are maily deal in export of beverges (Pepsi, 7up, Coca Cola, Vimto) , we export these products in all forms 330 Cans, and PET bottles, 500 ML, 1. 25 ML, 2000 ML
We offer these products at a... Больш падрабязна »
- Медныя руды
- Khartoum
- Судан
supplyautonomy.com/maglonatradingcompany.ca
- Медныя руды
- Markham
- Канада
supplyautonomy.com/pasarayaunggulsdnbhd.my
Generally Trading Company with specialization in Hand Painted Batik clothing
- Медныя руды
- Indahpura, Kulaijaya
- Малайзія
supplyautonomy.com/themineralscompanysa.co
- Медныя руды
- Bogota
- Калумбія
supplyautonomy.com/discovery.ao
Discovery is a local corporation in the heart of Luanda, Angolan capital city. In association with the Angolan Goverment it holds sveral property rights on Natural resources mainly located in the... Больш падрабязна »
- Медныя руды
- Luanda
- Ангола
supplyautonomy.com/transislandminingdevcorp.ph
We are basically a relatively new company which is on the process of developing mining areas all in our country for the major pursuit of supplying said minerals to China. Aside from... Больш падрабязна »
- Медныя руды
- Cebu City
- Філіпіны
supplyautonomy.com/mrcabucoexportimporttrading.ph
Our company has experiences of axporting mineral ores from philippines to other parts of the world.. Our main office is located at city of san fernando and we have sattelite offices at baguio city,... Больш падрабязна »
- Медныя руды
- San Fernando
- Філіпіны