Leitarniðurstöður fyrir: Kopar málmgrýti

Fundust 745 fyrirtæki


supplyautonomy.com/merecouklimited.gb
We can Supply Lead ore, Copper Ore and Timer
  • Kopar málmgrýti
  • London
  • Bretland
supplyautonomy.com/mbros.tz
MBROS Is registered mining company, and based in Dar-Es-Salaam, Tanzania. It is private owned company and producer of value added copper. MBROS has successfully secured other high quality... Lesa meira »
  • Kopar málmgrýti
  • Dar-Es-Salaam
  • Tansanía
supplyautonomy.com/metalcosarlchinaoffice.de
Metalco is a mining company in Berlin, Germany, we have our own mines in D.R. Congo, Africa. Our main products: TANTALITE COLTAN ORE Ta2O5, Cobalt Ore, Tin ore/concentrate,Copper ore/concentrate ... Lesa meira »
  • Kopar málmgrýti
  • Berlin
  • Þýskaland
supplyautonomy.com/globalmetalslimited.cm
global metals cameroon is specialized in the extraction and trading of iron ore, lead ore chrome ore,copper ore. we do export in any part of the world. our company has been in existence since 1999.... Lesa meira »
  • Kopar málmgrýti
  • Bamenda
  • Kamerún
supplyautonomy.com/arcinternationaltrading.za
Kankana Holdings is a Sales Distribution company based in Durban South Africa. We specialise in forming partnerships with major and indepenedent retailers for whome we source key retail products. ... Lesa meira »
  • Kopar málmgrýti
  • Durban, Pinetown
  • Suður-Afríka
supplyautonomy.com/tlholegoholdingptyltd.za
We are a south african company, well connected in africa, able to facilitate a wide variety of deals, we also act as a consulting company for businesses, presenting them with viable solutions for... Lesa meira »
  • Kopar málmgrýti
  • Pretoria
  • Suður-Afríka
supplyautonomy.com/uhurushipping.za
uhuru is a customs clearing and fowarding co.we do a lot of work in to africa a subsidery co. called Prinvee Trucking does all our transport into Africa so if any commodity is required we will... Lesa meira »
  • Kopar málmgrýti
  • Durban
  • Suður-Afríka
supplyautonomy.com/tisoknventurestrading.za
Tisokn Ventures Trading is a sourcing, procurement and supply chain management consulting firm focusing primarily on International Companies looking at procuring Chrome commodities resources from... Lesa meira »
  • Kopar málmgrýti
  • Johannesburg
  • Suður-Afríka
supplyautonomy.com/comercialpecemixsa.cl
Commercial company dedicated to the import and export of nutritional, honey, mineral products and wood. Our company at the comercial area it is new, born product of the necessities of the existing... Lesa meira »
  • Kopar málmgrýti
  • Santiago
  • Chíle
supplyautonomy.com/affinitysa.cl
We are a Chilean copper company. We produce copper concentrate 28/32%. Our usually procedure is the following: Introduction of your company Request of prouct Quantity Port of... Lesa meira »
  • Kopar málmgrýti
  • Santiago
  • Chíle
supplyautonomy.com/asdingenieriasa.cl
Provide Mining engineering services, Mine geology, Mine planning, Plant design, Plant operation. Ore handling, Ore concentration, Tailing dams and Environmental protection. Copper selling and... Lesa meira »
  • Kopar málmgrýti
  • Santiago
  • Chíle
supplyautonomy.com/zazzyglobalresources.ng
May we introduce our organization ZAZZY GLOBAL RESOURCES LTD to You? ZAZZY GLOBAL RESOURCES LTD is an organization which is registered with both CORPORATE AFFAIRS COMMISSION (CAC) NIGERIA EXPORT... Lesa meira »
  • Kopar málmgrýti
  • Ikeja
  • Nígería
supplyautonomy.com/tripleinheritancegrits.ng
We are dealers / agents of different kinds of solid minerals (metals, on-metals and gemstones rough) that are abundant in Nigeria, We recently acquired our mining company; Gosello Ltd which has been... Lesa meira »
  • Kopar málmgrýti
  • Jos
  • Nígería
supplyautonomy.com/msmtechconsulting.gb
Product: Iraqi light crude oil Price: Below the market. Contact us for more precisions. Contract quantity:10 million barrels total,50,000+ per day. Contract performance duration/scheduled... Lesa meira »
  • Kopar málmgrýti
  • London
  • Bretland
supplyautonomy.com/cjbennettimportexportagency.gb
From Kenya we can supply both green and roasted Arabica coffee beans, (Orgainc + Non orgainic) as well as black and green tea leaves. We buy both the coffee and tea direct from the auctions to gain... Lesa meira »
  • Kopar málmgrýti
  • Southampton
  • Bretland
supplyautonomy.com/goldentransfermarketingservices.ph
Golden Transfer Marketing Services is a duly registered and licensed trading service company in the Philippines. We are engaged in trading of scrap vessel metal and by-products (iron, aluminum,... Lesa meira »
  • Kopar málmgrýti
  • Manila
  • Filippseyjar
supplyautonomy.com/pakistancommoditiesinternationaltrade.pk
PAKISTAN COMMODITIES INTERNATIONAL TRADE (PCIT), have attained pinnacles of success in our domain. Owing to our passion for success and commitment to quality, we soon grew into a prominent... Lesa meira »
  • Kopar málmgrýti
  • Karachi
  • Pakistan
supplyautonomy.com/taranainternational.pk
Tarana International is trading company, I Capt.Tarana Saleem owner of this company. we are ship breakers, Importers and Exporters in Pakistan. we have lot of Copper ore and Iron ore in our mines
  • Kopar málmgrýti
  • Karachi
  • Pakistan
supplyautonomy.com/sir.cn
We are engaged in trading and investement in mienrals and energy field, the materials asre mainly used in based industries and Aerospace and relative industries, best serving for esteemed customers... Lesa meira »
  • Kopar málmgrýti
  • Pudong
  • Kína
supplyautonomy.com/sambhicresourcesfzc.ae
  • Kopar málmgrýti
  • Dubai
  • Sameinuðu arabísku furstadæmin
supplyautonomy.com/milandonyaietejarat.ir
  • Kopar málmgrýti
  • Tehran
  • Íran
supplyautonomy.com/sstco1.ir
We are SST Co. As technical and trading Co in Iran. We could supply Iron ore, copper sulphate, zinc sulphate from Iran with the best quality and price. We will send you the detail spesifications... Lesa meira »
  • Kopar málmgrýti
  • Mashad
  • Íran
supplyautonomy.com/weipnekretnine.hr
  • Kopar málmgrýti
  • Varazdin
  • Króatía
supplyautonomy.com/nyenterprises.sd
We are maily deal in export of beverges (Pepsi, 7up, Coca Cola, Vimto) , we export these products in all forms 330 Cans, and PET bottles, 500 ML, 1. 25 ML, 2000 ML We offer these products at a... Lesa meira »
  • Kopar málmgrýti
  • Khartoum
  • Súdan
supplyautonomy.com/maglonatradingcompany.ca
  • Kopar málmgrýti
  • Markham
  • Kanada
supplyautonomy.com/pasarayaunggulsdnbhd.my
Generally Trading Company with specialization in Hand Painted Batik clothing
  • Kopar málmgrýti
  • Indahpura, Kulaijaya
  • Malasía
supplyautonomy.com/themineralscompanysa.co
  • Kopar málmgrýti
  • Bogota
  • Kólumbía
supplyautonomy.com/discovery.ao
Discovery is a local corporation in the heart of Luanda, Angolan capital city. In association with the Angolan Goverment it holds sveral property rights on Natural resources mainly located in the... Lesa meira »
  • Kopar málmgrýti
  • Luanda
  • Angóla
supplyautonomy.com/transislandminingdevcorp.ph
We are basically a relatively new company which is on the process of developing mining areas all in our country for the major pursuit of supplying said minerals to China. Aside from... Lesa meira »
  • Kopar málmgrýti
  • Cebu City
  • Filippseyjar
supplyautonomy.com/mrcabucoexportimporttrading.ph
Our company has experiences of axporting mineral ores from philippines to other parts of the world.. Our main office is located at city of san fernando and we have sattelite offices at baguio city,... Lesa meira »
  • Kopar málmgrýti
  • San Fernando
  • Filippseyjar