Loading...
Որոնման արդյունքները: Տպագրություն եւ գրաֆիկա սարքավորումներ
Գտնվել է X կազմակերպությունՆախընտրեց ցանկեր կապված: Տպագրություն եւ գրաֆիկա սարքավորումներ
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... Կարդալ ավելին »
- Bag կատարելու մեքենաներ | Տպագրություն եւ գրաֆիկա սարքավորումներ | Թուղթ տեսակավորման մեքենաներ եւ սարքավորումներ | Հատա...
- Hyderabad
- Հնդկաստան
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Կարդալ ավելին »
- Անվտանգության արտադրանքի գործակալները | Փոխանցում տպագրություն | Ներարկման համաձուլվածքներ ծառայություններ, մետաղական | ...
- Amravati
- Հնդկաստան
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Կարդալ ավելին »
- Անվտանգության արտադրանքի գործակալները | Փոխանցում տպագրություն | Ներարկման համաձուլվածքներ ծառայություններ, մետաղական | ...
- Mumbai
- Հնդկաստան
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Կարդալ ավելին »
- Անվտանգության արտադրանքի գործակալները | Փոխանցում տպագրություն | Ներարկման համաձուլվածքներ ծառայություններ, մետաղական | ...
- Faridabad
- Հնդկաստան
supplyautonomy.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... Կարդալ ավելին »
- Այլ հագուստի մեքենաներ | Տպագրություն եւ գրաֆիկա սարքավորումներ | Թուղթ making մեքենաներ, շարունակական, գլան | Moulds, գ...
- Mumbai
- Հնդկաստան
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Կարդալ ավելին »
- Անվտանգության արտադրանքի գործակալները | Փոխանցում տպագրություն | Ներարկման համաձուլվածքներ ծառայություններ, մետաղական | ...
- Bardoli
- Հնդկաստան
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Կարդալ ավելին »
- Անվտանգության արտադրանքի գործակալները | Փոխանցում տպագրություն | Ներարկման համաձուլվածքներ ծառայություններ, մետաղական | ...
- Ahmedabad
- Հնդկաստան
supplyautonomy.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... Կարդալ ավելին »
- Անվտանգության արտադրանքի գործակալները | Փոխանցում տպագրություն | Ներարկման համաձուլվածքներ ծառայություններ, մետաղական | ...
- Pune
- Հնդկաստան
supplyautonomy.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... Կարդալ ավելին »
- Անվտանգության արտադրանքի գործակալները | Փոխանցում տպագրություն | Ներարկման համաձուլվածքներ ծառայություններ, մետաղական | ...
- Kalol
- Հնդկաստան
supplyautonomy.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- Տպագրություն եւ գրաֆիկա սարքավորումներ | Տպագրություն մամլիչներ, մխոց, մեկ հեղափոխություն | Տպագրություն մամլիչներ, մխոց...
- Wadhwan
- Հնդկաստան
supplyautonomy.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... Կարդալ ավելին »
- Պայուսակներ | Թաց steaming մեքենաներ, տեքստիլ | Չոր steaming մեքենաներ, տեքստիլ | Steaming սարքավորումներ, ցածր ճնշման, ...
- New Delhi
- Հնդկաստան
supplyautonomy.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... Կարդալ ավելին »
- Անվտանգության արտադրանքի գործակալները | Փոխանցում տպագրություն | Ներարկման համաձուլվածքներ ծառայություններ, մետաղական | ...
- Ilkal
- Հնդկաստան
supplyautonomy.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- Ներմուծողները, արտահանողները, թուղթ | Զուգարանի թուղթ | Անձեռոցիկներ, թաշկինակներ ու դեմքի հյուսվածքները, բջջանյութ բամբ...
- Jodhpur
- Հնդկաստան
supplyautonomy.com/laxmiudyog.in
- Անվտանգության արտադրանքի գործակալները | Փոխանցում տպագրություն | Ներարկման համաձուլվածքներ ծառայություններ, մետաղական | ...
- Mumbai
- Հնդկաստան
supplyautonomy.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... Կարդալ ավելին »
- Կցորդիչներ | Ball փականներ | Butterfly փականներ | Conveyor գոտիներ, օպտիկամանրաթելային ցեմենտի | Ֆլոմաստեր ցեմենտ արտադր...
- Howrah
- Հնդկաստան
supplyautonomy.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ | Թուղթ մշակման սարքավորումներ | Տպիչներ եւ մատյաններ...
- Ahmedabad
- Հնդկաստան
supplyautonomy.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... Կարդալ ավելին »
- Ձգվել ֆիլմ | Տպագրություն եւ գրաֆիկա սարքավորումներ | Փաթեթավորում մեքենաներ...
- Wenzhou
- Չինաստան
supplyautonomy.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ | Թուղթ մշակման սարքավորումներ | Հաստոցներ համար MILLING մետաղի...
- Cangzhou
- Չինաստան
supplyautonomy.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ | Լազերային տեխնիկա
- Shenzhen
- Չինաստան
supplyautonomy.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... Կարդալ ավելին »
- Մաքրման սարքավորումներ | Տպագրություն եւ գրաֆիկա սարքավորումներ
- Taixing
- Չինաստան
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ | Այլ նյութական մշակման սարքավորումներ...
- Wenzhou
- Չինաստան
supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Կարդալ ավելին »
- Bag կատարելու մեքենաներ | Տպագրություն եւ գրաֆիկա սարքավորումներ
- Ruian
- Չինաստան
supplyautonomy.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... Կարդալ ավելին »
- Bag կատարելու մեքենաներ | Տպագրություն եւ գրաֆիկա սարքավորումներ
- Ruian
- Չինաստան
supplyautonomy.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... Կարդալ ավելին »
- Bag կատարելու մեքենաներ | Տպագրություն եւ գրաֆիկա սարքավորումներ
- Ruian
- Չինաստան
supplyautonomy.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ | Թուղթ արտադրանքի պատրաստման մեքենաներ...
- Dongguan
- Չինաստան
supplyautonomy.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... Կարդալ ավելին »
- Պարկեր եւ պայուսակներ | Կարում մեքենաներ | Տպագրություն եւ գրաֆիկա սարքավորումներ | Փաթեթավորում մեքենաներ...
- Wenzhou
- Չինաստան
supplyautonomy.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... Կարդալ ավելին »
- Այլ տեքստիլ մեքենաներ | Տպագրություն եւ գրաֆիկա սարքավորումներ
- Ahmedabad
- Հնդկաստան
supplyautonomy.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... Կարդալ ավելին »
- Bag կատարելու մեքենաներ | Տպագրություն եւ գրաֆիկա սարքավորումներ | Փաթեթավորում մեքենաներ...
- Vadodara
- Հնդկաստան
supplyautonomy.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... Կարդալ ավելին »
- Մանածագործական հարդարման սարքեր | Տպագրություն եւ գրաֆիկա սարքավորումներ | Փաթեթավորում մեքենաներ...
- Ahmedabad
- Հնդկաստան
supplyautonomy.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ | Ցեմենտ պայուսակներ | Էլեկտրական եւ էլեկտրոնային սարքավորումներ...
- Ahmedabad
- Հնդկաստան