தேடல் முடிவுகள்: ரசாயனங்கள் மற்றும் ரசாயன பொருட்கள் உற்பத்தி

காணப்படும் 489 நிறுவனங்கள்


supplyautonomy.com/mediwelllaboratories.in
We are An ISO 9001:2015 , certified and is listed on all Drug updates. Our sister concern are Mediwell wellness , mediwell wellness & Phytomolecules Marcwell Laboratories , All of our... மேலும் வாசிக்க »
  • ஒப்பனை செயலாக்க | மூலிகை மருத்துவம் | மூலிகை மருந்து | தனிப்பட்ட பராமரிப்பு பொருட்கள் | ஆண்கள் பாதுகாப்பு | ஒப்பனை...
  • Ambala City
  • இந்தியா
supplyautonomy.com/sofresidengineering.fr
  • Pipework ஒப்பந்தக்காரர்கள், இரசாயன மற்றும் அணு கழிவுகளை அமைப்புகள் | Pipework நிறுவல் ஒப்பந்தக்காரர்கள், ரசாயன ஆலை | Pip...
  • Montigny-le-Bretonneux
  • பிரான்ஸ்
supplyautonomy.com/sweco.us
  • இரசாயன தொழில் கெட்டிப்பொருள்களை Sieving | Humidifiers, உணவு, சமையல் தாவர எண்ணெய் சுத்திகரிப்பு | ஹீட்டர்கள், சமையல் எண...
  • Florence
  • ஐக்கிய அமெரிக்க குடியரசு
supplyautonomy.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... மேலும் வாசிக்க »
  • உற்பத்தி சேவைகள், உணவுத்திட்ட | சேவைகள், கரைப்பான்கள் மற்றும் பசைகள், தொழில்துறை பூர்த்தி மற்றும் தொகுப்பது | மருந்துக...
  • New Delhi
  • இந்தியா
supplyautonomy.com/gujaratfluorochemicalslimited.in
Gujarat Fluorochemicals Limited (GFL) is an Indian Chemicals Company with over 30 years of expertise in Fluorine Chemistry. GFL holds domain expertise in Fluoropolymers, Fluorospecialities,... மேலும் வாசிக்க »
  • இரசாயன உற்பத்தி | வேதியியல் பொருள்கள்
  • Noida
  • இந்தியா
supplyautonomy.com/texmor.mx
In 1981, the painting factory Permil S.A. of C.V. I think you will sit in the market of the surest. Our mission is to protect and decorate beautifully designed motifs for the three brothers, written... மேலும் வாசிக்க »
  • சாயங்கள் மற்றும் நிறமிகள் உற்பத்தி | வர்ணங்கள், varnishes மற்றும் ஒத்த பூச்சுகள், அச்சிடும் மை மற்றும் mastics உற்பத்திய...
  • Xochitepec
  • மெக்சிகோ
supplyautonomy.com/embelezarkosmetikinstitut.ca
So wie ich mir für meine Haut nur das Beste gönne, lege ich auch in meinem Kosmetikstudio in Frankfurt größten Wert auf die Qualität meiner kosmetischen Produkte und Behandlungen. Als langjährig erfah... மேலும் வாசிக்க »
  • ஒப்பனை சிகிச்சை சேவைகள் | ஒப்பனை செயலாக்க
  • Frankfurt am Main
  • ஜெர்மன்
supplyautonomy.com/shandongrunkechemicalco.cn
Shandong Runke Chemical Co., Ltd. was established in 2006 and finished holding and restructuring of Weifang Dacheng Salinization Co., Ltd. to the company in 2010. With a registered capital of 40... மேலும் வாசிக்க »
  • மற்ற ரசாயன பொருட்கள் உற்பத்தி பூச்சியால் வரும் வியாதிதான் | இரசாயன பொருட்கள் | , புரோமின் திட, திரவ அல்லது வாயு...
  • Weifang
  • சீனா
supplyautonomy.com/shandongsunshinechemicaltechnologyco.cn
Shandong Sunshine Chemical Technology Co., Ltd. specializes in R&D, production and management of disinfectant, additives and polymer, and its factory was built in accordance with GMP standards.... மேலும் வாசிக்க »
  • மற்ற ரசாயன பொருட்கள் உற்பத்தி பூச்சியால் வரும் வியாதிதான் | நீச்சல் குளங்கள் ஐந்து குளோரின் ஜெனரேட்டர்கள் | இரசாயன பொ...
  • Yanggu
  • சீனா
supplyautonomy.com/northeastagrochem.cn
Agrochemicals products. Main products: Malathion, Chlorpyrifos, Thiamethoxam, and others. (Technical and Formulation) Aгрохимикатов продукции. Основная продукция: Малатион, Хлорпирифос, Тиаметокса... மேலும் வாசிக்க »
  • பூச்சிக்கொல்லிகள் மற்றும் மற்ற விவசாய ரசாயனங்களின் பொருட்கள் உற்பத்தி | விவசாய வேதிகள் | விவசாய ரசாயனங்களின் | மற்ற வி...
  • Jinxi
  • சீனா
supplyautonomy.com/chemiplastinternational.pk
Chemiplast International is a strong, family rooted company – founded by a cotton trading veteran Mr. Abid Ali (late) in 1999 with a vision to make Chemiplast one of the leading trading companies ... மேலும் வாசிக்க »
  • பாலியூரிதீன் (Pu) | பாலிமர்ஸ் | கரைப்பான்கள் | மற்ற ரசாயன பொருட்கள் உற்பத்தி | ரசாயனங்கள் மற்றும் ரசாயன பொருட்கள் உற்ப...
  • Karachi
  • பாகிஸ்தான்
supplyautonomy.com/varunpolymers.in
Varun Polymers is one of the leading manufacturer and exporter in India, of premium quality recycled rubber products. We manufacture rubber reclaiming agent such as: 1 Di Aryl Di Sulphide 2 ... மேலும் வாசிக்க »
  • விருப்ப இரசாயன சேவைகள் | பந்து வால்வுகள் | பிளாஸ்டிக் பொருட்கள் | ஒட்டிகள் மற்றும் நாடா | Moulded கூறுகள், குவார்ட்ஸ் இ...
  • Ahmedabad
  • இந்தியா
supplyautonomy.com/todecasa.es
  • வகைப்பாடு சேவைகள், ரசாயனப்பொருட்கள் | இரசாயன வடித்தல் | பான தொழில் ஈஸ்ட் | ஈஸ்ட், ரொட்டி விற்பவன் ' | மிட்டாய் ஈஸ்ட்,...
  • Barcelona
  • ஸ்பெயின்
supplyautonomy.com/eastmanchemicalcompany.us
  • விருப்ப இரசாயன சேவைகள் | சோடியம், திரவ | சோடியம் metabisulphite / சோடியம் pyrosulphite | சோடியம் மெத்தாக்ஸைடுக்கு / ...
  • Kingsport
  • ஐக்கிய அமெரிக்க குடியரசு
supplyautonomy.com/lgobbisrl.it
  • உற்பத்தி சேவைகள், உணவுத்திட்ட | வினையூக்கிகளுல் மீளுருவாக்கம் | செயல்படுத்தப்பட்டது கார்பன் மீளுருவாக்கம் சேவைகள் | புகை...
  • CAMPO LIGURE (GE)
  • இத்தாலி
supplyautonomy.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... மேலும் வாசிக்க »
  • உற்பத்தி சேவைகள், உணவுத்திட்ட | மருந்துகள் கலத்தல் | மருந்துகள் உலர்த்திய தெளிக்க | புரதம் சுத்திகரிப்பு சேவைகள் | மனித ...
  • Bengaluru
  • இந்தியா
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... மேலும் வாசிக்க »
  • மீட்பு மற்றும் ஆவியாகக்கூடிய கரிம சேர்மங்கள் மீளுருவாக்கம் (VOC) | புரதம் சுத்திகரிப்பு சேவைகள் | இரசாயன தொழில் திரவங்க...
  • Rajagiriya
  • இலங்கை
supplyautonomy.com/developpementbernardplasencia.fr
  • மருந்து உற்பத்தி பொறியியல் நிபுணர்கள் | உயிர்வேதியியல் பொறியியல் நிபுணர்கள் | செயல்படுத்தப்பட்டது கார்பன் மீளுருவாக்கம...
  • Saint-Priest
  • பிரான்ஸ்
supplyautonomy.com/aircontrolsa.es
  • குளிர்த்துபொறித்தொகுதி, ஆயத்த தயாரிப்பு திட்டங்கள் | உற்பத்தி சேவைகள், உணவுத்திட்ட | மருந்துகள் கலத்தல் | மருந்துகள் உ...
  • San Sebastián
  • ஸ்பெயின்
supplyautonomy.com/borgessa.es
  • கூழ் ஏற்றம், பூச்சு கொண்ட | உற்பத்தி சேவைகள், உணவுத்திட்ட | பொருட்கள் வியாபாரிகள், கச்சா ரப்பர் மற்றும் பாலை | பொருட்...
  • Reus
  • ஸ்பெயின்
supplyautonomy.com/crealis.fr
  • மேலாண்மை ஆலோசனை | இரசாயன வடித்தல் | மின் மற்றும் மின்னணு நிறுவலுக்கு, பொருட்கள், இரசாயன சுத்தம் | தரவு செயலாக்க கருவிக...
  • Bry
  • பிரான்ஸ்
supplyautonomy.com/novissrl.it
  • Synthesising சேவைகள், இரசாயன | உலோகங்கள் Chromating இரசாயனங்கள் | குரோமியம் முலாம் இரசாயனங்கள் | எரிபொருள் எண்ணெய் கூ...
  • Calenzano
  • இத்தாலி
supplyautonomy.com/azelisfrance.fr
  • உற்பத்தி சேவைகள், உணவுத்திட்ட | கெமிக்கல்ஸ் - ஏற்றுமதி இறக்குமதி | மருந்துகள் கலத்தல் | மருந்துகள் உலர்த்திய தெளிக்க | ப...
  • Paris
  • பிரான்ஸ்
supplyautonomy.com/epiingredients.fr
  • மருந்துகள் கலத்தல் | இரசாயன தொழில் வண்ணப்பூச்சுகள் மற்றும் நிறமிகளை கலத்தல் | இஞ்சி எண்ணெய் | தூள் மற்றும் அமுக்கப்பட்ட...
  • Ancenis
  • பிரான்ஸ்
supplyautonomy.com/ktronfrance.fr
  • உற்பத்தி சேவைகள், உணவுத்திட்ட | சேவைகள், கரைப்பான்கள் மற்றும் பசைகள், தொழில்துறை பூர்த்தி மற்றும் தொகுப்பது | மருந்துக...
  • Croissy-sur-Celle
  • பிரான்ஸ்
supplyautonomy.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... மேலும் வாசிக்க »
  • தொழில்நுட்ப பொறியியல் நிபுணர்கள் கலந்து மற்றும் கலத்தல் | உற்பத்தி சேவைகள், உணவுத்திட்ட | மருந்துகள் கலத்தல் | மருந்து...
  • Runcorn
  • பிரிடிஷ் கூட்டரசு
supplyautonomy.com/ajantachemicals.in
Manufacturers and Exporters of Agro Chemicals, Organic Chemicals and Inorganic Chemicals.
  • உற்பத்தி சேவைகள், உணவுத்திட்ட | மருந்துகள் கலத்தல் | மருந்துகள் உலர்த்திய தெளிக்க | புரதம் சுத்திகரிப்பு சேவைகள் | மனித ...
  • New Delhi
  • இந்தியா
supplyautonomy.com/standardplasticatehnicsrl.ro
  • தொழிற்சாலை மற்றும் சாதனம் பொறியியல் நிபுணர்கள் பேக்கேஜிங் மற்றும் பூர்த்தி | அச்சடிக்கப்பட்ட சர்க்யூட் போர்ட் (பிசிபி...
  • Bucuresti
  • ருமேனியா
supplyautonomy.com/swecoeuropedivisionfrance.fr
  • இரசாயன தொழில் திரவங்கள் என்ற Sieving | இரசாயன தொழில் கெட்டிப்பொருள்களை Sieving | இரசாயன தொழில் பசைகள் என்ற Sieving |...
  • VALENCIENNES
  • பிரான்ஸ்
supplyautonomy.com/chemineerlimited.gb
  • கலந்து மற்றும் ரசாயன துறை பசைகள் கலத்தல் | மிக்சர்கள், வெடிமருந்துகள் தயாரிப்பு | வெடி உபகரணங்கள் உலர்த்திய | உபகரணங்கள்...
  • Derby
  • பிரிடிஷ் கூட்டரசு