Loading...
தேடல் முடிவுகள்: அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்
காணப்படும் 277 நிறுவனங்கள்தொடர்பான விருப்பமான பட்டியல்கள்: அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... மேலும் வாசிக்க »
- பை இயந்திரங்கள் செய்யும் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | காகித வரிசையாக்க இயந்திரங்கள் மற்றும் உபகரணங்கள் |...
- Hyderabad
- இந்தியா
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... மேலும் வாசிக்க »
- பாதுகாப்பு தயாரிப்பு முகவர் | பரிமாற்ற அச்சிடும் | ஊசி மருந்து வடிவமைத்தல் சேவைகள், உலோக | காப்பு பொருட்கள் | விருப்ப ...
- Amravati
- இந்தியா
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... மேலும் வாசிக்க »
- பாதுகாப்பு தயாரிப்பு முகவர் | பரிமாற்ற அச்சிடும் | ஊசி மருந்து வடிவமைத்தல் சேவைகள், உலோக | காப்பு பொருட்கள் | விருப்ப ...
- Mumbai
- இந்தியா
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... மேலும் வாசிக்க »
- பாதுகாப்பு தயாரிப்பு முகவர் | பரிமாற்ற அச்சிடும் | ஊசி மருந்து வடிவமைத்தல் சேவைகள், உலோக | காப்பு பொருட்கள் | விருப்ப ...
- Faridabad
- இந்தியா
supplyautonomy.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... மேலும் வாசிக்க »
- மற்ற ஆடைகள் இயந்திரங்கள் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | அட்டை செய்யும் இயந்திரங்கள், தொடர், உருளை | Mould...
- Mumbai
- இந்தியா
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... மேலும் வாசிக்க »
- பாதுகாப்பு தயாரிப்பு முகவர் | பரிமாற்ற அச்சிடும் | ஊசி மருந்து வடிவமைத்தல் சேவைகள், உலோக | காப்பு பொருட்கள் | விருப்ப ...
- Bardoli
- இந்தியா
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... மேலும் வாசிக்க »
- பாதுகாப்பு தயாரிப்பு முகவர் | பரிமாற்ற அச்சிடும் | ஊசி மருந்து வடிவமைத்தல் சேவைகள், உலோக | காப்பு பொருட்கள் | விருப்ப ...
- Ahmedabad
- இந்தியா
supplyautonomy.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... மேலும் வாசிக்க »
- பாதுகாப்பு தயாரிப்பு முகவர் | பரிமாற்ற அச்சிடும் | ஊசி மருந்து வடிவமைத்தல் சேவைகள், உலோக | காப்பு பொருட்கள் | விருப்ப ...
- Pune
- இந்தியா
supplyautonomy.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... மேலும் வாசிக்க »
- பாதுகாப்பு தயாரிப்பு முகவர் | பரிமாற்ற அச்சிடும் | ஊசி மருந்து வடிவமைத்தல் சேவைகள், உலோக | காப்பு பொருட்கள் | விருப்ப ...
- Kalol
- இந்தியா
supplyautonomy.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | அச்சிடும் அச்சகங்கள், உருளை, ஒற்றை புரட்சியின் | அச்சிடும் அச்சகங்கள், சிலிண்...
- Wadhwan
- இந்தியா
supplyautonomy.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... மேலும் வாசிக்க »
- பைகள் | ஈரமான வேகவைக்கும் இயந்திரங்கள், ஜவுளி | உலர் வேகவைக்கும் இயந்திரங்கள், ஜவுளி | வெள்ளாவி உபகரணங்கள், குறைந்த அழுத...
- New Delhi
- இந்தியா
supplyautonomy.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... மேலும் வாசிக்க »
- பாதுகாப்பு தயாரிப்பு முகவர் | பரிமாற்ற அச்சிடும் | ஊசி மருந்து வடிவமைத்தல் சேவைகள், உலோக | காப்பு பொருட்கள் | விருப்ப ...
- Ilkal
- இந்தியா
supplyautonomy.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- இறக்குமதியாளர்கள், ஏற்றுமதியாளர்கள், காகித | கழிவறை பேப்பர் | நாப்கின்கள், கைக்குட்டைகளை மற்றும் முக திசுக்கள், செல்லுலே...
- Jodhpur
- இந்தியா
supplyautonomy.com/laxmiudyog.in
- பாதுகாப்பு தயாரிப்பு முகவர் | பரிமாற்ற அச்சிடும் | ஊசி மருந்து வடிவமைத்தல் சேவைகள், உலோக | காப்பு பொருட்கள் | விருப்ப ...
- Mumbai
- இந்தியா
supplyautonomy.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... மேலும் வாசிக்க »
- டம் | பந்து வால்வுகள் | பட்டாம்பூச்சி வால்வுகள் | கன்வேயர் பெல்ட்கள், நார் சிமெண்ட் | இழை சிமெண்ட் உற்பத்தி, தீ தடுப்பு ...
- Howrah
- இந்தியா
supplyautonomy.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... மேலும் வாசிக்க »
- அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | காகித செயலாக்க இயந்திரங்கள் | பிரிண்டர்கள் & பைண்டர்கள்...
- Ahmedabad
- இந்தியா
supplyautonomy.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... மேலும் வாசிக்க »
- நீட்டிக்க படம் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
- Wenzhou
- சீனா
supplyautonomy.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... மேலும் வாசிக்க »
- அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | காகித செயலாக்க இயந்திரங்கள் | அரைக்கும் உலோக இயந்திர கருவிகள்...
- Cangzhou
- சீனா
supplyautonomy.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... மேலும் வாசிக்க »
- அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | லேசர் உபகரணம்...
- Shenzhen
- சீனா
supplyautonomy.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... மேலும் வாசிக்க »
- உபகரணங்கள் சுத்தம் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்...
- Taixing
- சீனா
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... மேலும் வாசிக்க »
- அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | மற்ற பொருளை கையாளுதல் உபகரணங்கள்...
- Wenzhou
- சீனா
supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... மேலும் வாசிக்க »
- பை இயந்திரங்கள் செய்யும் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்...
- Ruian
- சீனா
supplyautonomy.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... மேலும் வாசிக்க »
- பை இயந்திரங்கள் செய்யும் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்...
- Ruian
- சீனா
supplyautonomy.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... மேலும் வாசிக்க »
- பை இயந்திரங்கள் செய்யும் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்...
- Ruian
- சீனா
supplyautonomy.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... மேலும் வாசிக்க »
- அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | காகித தயாரிப்பு இயந்திரங்கள் செய்யும்...
- Dongguan
- சீனா
supplyautonomy.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... மேலும் வாசிக்க »
- சாக்குகளில் மற்றும் பைகள் | தையல் இயந்திரங்கள் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
- Wenzhou
- சீனா
supplyautonomy.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... மேலும் வாசிக்க »
- மற்ற ஜவுளி இயந்திரங்கள் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்...
- Ahmedabad
- இந்தியா
supplyautonomy.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... மேலும் வாசிக்க »
- பை இயந்திரங்கள் செய்யும் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
- Vadodara
- இந்தியா
supplyautonomy.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... மேலும் வாசிக்க »
- ஜவுளி-முடித்திருக்கிறார்கள் இயந்திரங்கள் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
- Ahmedabad
- இந்தியா
supplyautonomy.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... மேலும் வாசிக்க »
- அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | சிமெண்ட் மூட்டைகளை | மின் மற்றும் மின்னணு உபகரணங்கள்...
- Ahmedabad
- இந்தியா