தேடல் முடிவுகள்: அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்

காணப்படும் 277 நிறுவனங்கள்


supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... மேலும் வாசிக்க »
  • பை இயந்திரங்கள் செய்யும் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்...
  • Ruian
  • சீனா
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... மேலும் வாசிக்க »
  • அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | மற்ற பொருளை கையாளுதல் உபகரணங்கள்...
  • Wenzhou
  • சீனா
supplyautonomy.com/acmemachinerycompanypvt.in
Into Manufacturing of Paper Corrugated Carton Production Line, print finishing machines since last three decades with excellent customer base using range of our machine. The state of art... மேலும் வாசிக்க »
  • அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
  • Mumbai
  • இந்தியா
supplyautonomy.com/siadgroupsrl.it
SIAD GROUP srl provides end to end solutions for the new business of printing. We provide services and products including consulting, workflow and finishing printing equipment to match the... மேலும் வாசிக்க »
  • சூடான ஸ்டாம்பிங் படலம் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்...
  • Arese
  • இத்தாலி
supplyautonomy.com/ishaninternational.in
we leading manufacturer of plastic printing machine and bag making machines viz., Rotogravure Printing Machine, Flexo Printing Machine, Bag making machine, side sealing machine, Slitting... மேலும் வாசிக்க »
  • பை இயந்திரங்கள் செய்யும் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்...
  • Ahmedabad
  • இந்தியா
supplyautonomy.com/junsheng.cn
Our company is located in Dongguang County, Hebei Province, China. We are specialized in manufacturing all kinds of water base ink printing slotting die-cutting machines and whole sets of carton... மேலும் வாசிக்க »
  • உபகரணங்கள் சுத்தம் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | பேக்கேஜிங் இயந்திரங்கள் | துணை பேக்கேஜிங் உபகரணங்கள்...
  • Cangzhou
  • சீனா
supplyautonomy.com/zhejiangtianfengplasticmachineryplant.cn
Zhejiang Tianfeng Plastic Machinery Plant is a global supplier of standard and custom-engineered products and systems. Our products serve the complete range of PP/PE woven bag machine, leno mesh bag... மேலும் வாசிக்க »
  • பை இயந்திரங்கள் செய்யும் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்...
  • Wenzhou
  • சீனா
supplyautonomy.com/vishvaeximpvt.in
Manufacturer and Exporters of Roto Gravure Printing Machine, Flexo Graph Printing Machine, Laminators (Solvent less), Laminators (Base), Extrusion Machines, Small Packaging Machinery, Core Cutting... மேலும் வாசிக்க »
  • தண்டுகளையும் | அச்சு உபகரணங்கள் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
  • Ahmedabad
  • இந்தியா
supplyautonomy.com/shanghaipripackmachineryco.cn
Shanghai Pripack Machinery Co., Ltd. is a company that specializes in providing printing & packaging machinery and production line. Owning experienced employees and cooperating with many... மேலும் வாசிக்க »
  • அலுமினியம் கலந்த | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
  • Shanghai
  • சீனா
supplyautonomy.com/bajajprintpackmachineriespvt.in
We supply hologram Machinery to produce holograms from hologram master shooting to die-cutting, includes hologram master shooting system (2D / 3D master and Dot-matrix master) , recombination... மேலும் வாசிக்க »
  • மற்ற ஆடைகள் இயந்திரங்கள் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
  • New Delhi
  • இந்தியா
supplyautonomy.com/mmmauenhandelsgesellschaftmbh.de
MMM established in 1986 are specialists in matches industry. Combination of integrity, high business ethics with sound consulatation, makes us your number one souce in Match Machinery and Material... மேலும் வாசிக்க »
  • அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | மற்ற பயன்படுத்தப்படும் இயந்திரங்கள் | புகையிலை மற்றும் புகை பொருட்களை...
  • Hamburg
  • ஜெர்மன்
supplyautonomy.com/natrajcorrugatingmachinerycompany.in
India's leading manufacturer and exporter of paper corrugated board and box making machinery since1955,Brand SUPER NATARAJA FORMERLY KNOWN AS NATARAJA. company have the experience of making... மேலும் வாசிக்க »
  • அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | மற்ற பொருளை கையாளுதல் உபகரணங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
  • New Delhi
  • இந்தியா
supplyautonomy.com/seniormachineryco.in
About Us Promoted by a Team of qualified professionals. Highly experienced in the machinery filed. We are 25 years old, out of which 15 years we were manufacturing Printing related... மேலும் வாசிக்க »
  • அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | காகித செயலாக்க இயந்திரங்கள் பாகங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
  • Pune
  • இந்தியா
supplyautonomy.com/alphagraphics737.us
At Alphagraphics 737 Grapevine, TX we have the skills and tools to help brand your company effectively. Call us for printing services, blueprint, car wraps, signs and banners.
  • கிராபிக்ஸ் பணிமனைகள் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | புளூபிரிண்ட்-நகலெடுத்து இயந்திரங்கள் | பிரிண்டர்கள் & ...
  • Grapevine
  • ஐக்கிய அமெரிக்க குடியரசு
supplyautonomy.com/webcoindustries.in
  • அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | அச்சுப்பொறி ஆஃப்செட்...
  • Faridabad
  • இந்தியா
supplyautonomy.com/lapraco.in
For more than 38 years, Lapra Co. has been constantly demonstrating its innovative power and is today one of the leading companies in the area of flexible packaging Our passion for ... மேலும் வாசிக்க »
  • அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | ரோட்டோகிரேவர் அச்சிடும் இயந்திரம்...
  • New Delhi
  • இந்தியா
supplyautonomy.com/multipresssrl.it
  • ஸ்டாம்பிங், பிளாஸ்டிக்குகள் - இயந்திரங்கள் | ஊசி, பிளாஸ்டிக்குகள் - இயந்திரங்கள் | பிளாஸ்டிக் - தொழில்துறை இயந்திரங்கள்...
  • Ponte San Marco
  • இத்தாலி
supplyautonomy.com/urstechnologyofindia.in
Breaking new grounds in the domain of printers and allied machines, we, URS Technology Of India, have captured a huge market share. Our products are of high quality and meet the industrial quality... மேலும் வாசிக்க »
  • அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | அச்சிடும் மை & பெயிண்ட் மூலப்பொருள்...
  • Kolkata
  • இந்தியா
supplyautonomy.com/suntrading.in
  • பைகள் | பணப்பைகள் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | அச்சுப்பொறி ஆஃப்செட் | அல்லாத நெய்த துணி...
  • Chennai
  • இந்தியா
supplyautonomy.com/kptechmachineindiapvt.in
  • துணிகள் | பைகள் | பணப்பைகள் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | வெல்டிங் உபகரணங்கள் | அல்லாத நெய்த துணி...
  • Ahmedabad
  • இந்தியா
supplyautonomy.com/hicmachineryco.in
  • மின்னணு பொருட்கள் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | பேக்கேஜிங் இயந்திரங்கள் | பிரிண்டர்கள் & பைண்டர்கள்...
  • Amritsar
  • இந்தியா
supplyautonomy.com/chinacangzhoujiajiamachinerymanufacture.cn
  • அடுக்கு மாடி 'கருவிகள் | மோட்டார் வாகன மின் மற்றும் மின்னணு உபகரணங்கள் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | Man...
  • Cangzhou
  • சீனா
supplyautonomy.com/babrahindustrialcorporation.in
About Babrah Industrial CorporationWe, Babrah Industrial Corporation, are meeting the bulk and urgent orders of our valued clients via our robust production facilities, supported distribution network... மேலும் வாசிக்க »
  • அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்
  • Amritsar
  • இந்தியா
supplyautonomy.com/carmelengineering.in
We are manufacturer, supplier and exporter of flexo printing machinery such as flexographic printing machine and apart from this we also deals into non woven printing machine, lamination machine,... மேலும் வாசிக்க »
  • அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்
  • Madurai
  • இந்தியா
supplyautonomy.com/universalinksvarnishplimited.in
In the field of Inks & Varnish, we 'Universal Inks & Varnish (P) Ltd.' are leading the market since 1981 as a renowned manufacturer, exporter, importer and supplier. Our company has... மேலும் வாசிக்க »
  • அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | அச்சிடப்பட்ட விஷயம் மற்றும் தொடர்புடைய தயாரிப்புகள் | அச்சிடும் மை & பெயிண்ட...
  • Delhi
  • இந்தியா
supplyautonomy.com/ramanindustries.in
In the year of 1971 the company was established and engaged itself as a paper converterand susequently in the year of 1973 it had started Machine manufacturing unit. Now-a-days it has covered area... மேலும் வாசிக்க »
  • பிளாஸ்டிக் லேமினேட்டிங் இயந்திரங்கள் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்...
  • Kolkata
  • இந்தியா
supplyautonomy.com/msenterprises20.in
To offer a comprehensive product line meeting the engineering needs of our clients, M.S. Enterprises was established in the year 1975. We are renowned in the industry as leading Manufacturer,... மேலும் வாசிக்க »
  • அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்
  • Faridabad
  • இந்தியா
supplyautonomy.com/asindustrialconsultingservices.in
Catering a range of integrated technical consultancy services to a varied range of industrial houses for setting up new projects in India or abroad...A.S. Industrial Consulting Services, thereafter... மேலும் வாசிக்க »
  • அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்
  • Gurgaon
  • இந்தியா
supplyautonomy.com/ruiancambridgemachinery.cn
Located in RUIAN, the well-known Soft Package City of China, Ruian CAMBRIDGE MACHINE I/E Company pours big energy in package machinery. In 2008, we got the foot in manufacturing of Plastic Film... மேலும் வாசிக்க »
  • பை இயந்திரங்கள் செய்யும் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள்...
  • Ruian
  • சீனா
supplyautonomy.com/marsonsprintgrafmachinespvt.in
  • ஒட்டிகள் மற்றும் நாடா | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | ரோட்டோகிரேவர் அச்சிடும் இயந்திரம் | பேக்கேஜிங் இயந்...
  • Mumbai
  • இந்தியா