Loading...
Результати пошуку для: Обладнання для друку та дизайну графічного
Знайдено 277 компаніїsupplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Детальніше »
- Механізм виготовлення сумки | Обладнання для друку та дизайну графічного...
- Ruian
- Китай
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Детальніше »
- Обладнання для друку та дизайну графічного | Інше обладнання обробки матеріалів...
- Wenzhou
- Китай
supplyautonomy.com/acmemachinerycompanypvt.in
Into Manufacturing of Paper Corrugated Carton Production Line, print finishing machines since last three decades with excellent customer base using range of our machine.
The state of art... Детальніше »
- Обладнання для друку та дизайну графічного | Пакувальне обладнання...
- Mumbai
- Індія
supplyautonomy.com/siadgroupsrl.it
SIAD GROUP srl provides end to end solutions for the new business of printing. We provide services and products including consulting, workflow and finishing printing equipment to match the... Детальніше »
- Термічна фольга | Обладнання для друку та дизайну графічного
- Arese
- Італія
supplyautonomy.com/ishaninternational.in
we leading manufacturer of plastic printing machine and bag making machines viz., Rotogravure Printing Machine, Flexo Printing Machine, Bag making machine, side sealing machine, Slitting... Детальніше »
- Механізм виготовлення сумки | Обладнання для друку та дизайну графічного...
- Ahmedabad
- Індія
supplyautonomy.com/junsheng.cn
Our company is located in Dongguang County, Hebei Province, China. We are specialized in manufacturing all kinds of water base ink printing slotting die-cutting machines and whole sets of carton... Детальніше »
- Устаткування для очищення | Обладнання для друку та дизайну графічного | Пакувальне обладнання | Допоміжне пакувальне об...
- Cangzhou
- Китай
supplyautonomy.com/zhejiangtianfengplasticmachineryplant.cn
Zhejiang Tianfeng Plastic Machinery Plant is a global supplier of standard and custom-engineered products and systems. Our products serve the complete range of PP/PE woven bag machine, leno mesh bag... Детальніше »
- Механізм виготовлення сумки | Обладнання для друку та дизайну графічного...
- Wenzhou
- Китай
supplyautonomy.com/vishvaeximpvt.in
Manufacturer and Exporters of Roto Gravure Printing Machine, Flexo Graph Printing Machine, Laminators (Solvent less), Laminators (Base), Extrusion Machines, Small Packaging Machinery, Core Cutting... Детальніше »
- Вали | Телексне обладнання | Обладнання для друку та дизайну графічного | Пакувальне обладнання...
- Ahmedabad
- Індія
supplyautonomy.com/shanghaipripackmachineryco.cn
Shanghai Pripack Machinery Co., Ltd. is a company that specializes in providing printing & packaging machinery and production line. Owning experienced employees and cooperating with many... Детальніше »
- Алюмінієві сплави | Обладнання для друку та дизайну графічного | Пакувальне обладнання...
- Shanghai
- Китай
supplyautonomy.com/bajajprintpackmachineriespvt.in
We supply hologram Machinery to produce holograms from hologram master shooting to die-cutting, includes hologram master shooting system (2D / 3D master and Dot-matrix master) , recombination... Детальніше »
- Інші швейні машини | Обладнання для друку та дизайну графічного | Пакувальне обладнання...
- New Delhi
- Індія
supplyautonomy.com/mmmauenhandelsgesellschaftmbh.de
MMM established in 1986 are specialists in matches industry.
Combination of integrity, high business ethics with sound consulatation, makes us your number one souce in Match Machinery and Material... Детальніше »
- Обладнання для друку та дизайну графічного | Інші використані механізми | Тютюн, товари для курців...
- Hamburg
- Німеччина
supplyautonomy.com/natrajcorrugatingmachinerycompany.in
India's leading manufacturer and exporter of paper corrugated board and box making machinery since1955,Brand SUPER NATARAJA FORMERLY KNOWN AS NATARAJA. company have the experience of making... Детальніше »
- Обладнання для друку та дизайну графічного | Інше обладнання обробки матеріалів | Пакувальне обладнання...
- New Delhi
- Індія
supplyautonomy.com/seniormachineryco.in
About Us
Promoted by a Team of qualified professionals. Highly experienced in the machinery filed.
We are 25 years old, out of which 15 years we were manufacturing Printing related... Детальніше »
- Обладнання для друку та дизайну графічного | Частини машини обробки паперових продуктів | Пакувальне обладнання...
- Pune
- Індія
supplyautonomy.com/alphagraphics737.us
At Alphagraphics 737 Grapevine, TX we have the skills and tools to help brand your company effectively. Call us for printing services, blueprint, car wraps, signs and banners.
- Автоматизованих робочих місць для графічних дизайнерів | Обладнання для друку та дизайну графічного | Світлокопіювальний...
- Grapevine
- США
supplyautonomy.com/webcoindustries.in
supplyautonomy.com/lapraco.in
For more than 38 years, Lapra Co. has been constantly demonstrating its innovative
power and is today one of the leading companies in the area of flexible packaging
Our passion for ... Детальніше »
- Обладнання для друку та дизайну графічного | Глибокі друкарські машини...
- New Delhi
- Індія
supplyautonomy.com/multipresssrl.it
- Листове штампування пластмас - обладнання | Лиття пластмас під тиском - обладнання | Пластмаси - промислове обладнання |...
- Ponte San Marco
- Італія
supplyautonomy.com/urstechnologyofindia.in
Breaking new grounds in the domain of printers and allied machines, we, URS Technology Of India, have captured a huge market share. Our products are of high quality and meet the industrial quality... Детальніше »
- Обладнання для друку та дизайну графічного | Друкарська фарба і фарба сировини...
- Kolkata
- Індія
supplyautonomy.com/suntrading.in
supplyautonomy.com/kptechmachineindiapvt.in
- Тканини | Сумки та дорожні аксесуари | Гаманці | Обладнання для друку та дизайну графічного | Зварювання | Неткані ткани...
- Ahmedabad
- Індія
supplyautonomy.com/hicmachineryco.in
- Електронні аксесуари | Обладнання для друку та дизайну графічного | Пакувальне обладнання | Принтери й сполучні...
- Amritsar
- Індія
supplyautonomy.com/chinacangzhoujiajiamachinerymanufacture.cn
- Інструменти для будівельних робіт | Електричне та електронне обладнання автомобілів і автотранспортних засобів | Обладна...
- Cangzhou
- Китай
supplyautonomy.com/babrahindustrialcorporation.in
About Babrah Industrial CorporationWe, Babrah Industrial Corporation, are meeting the bulk and urgent orders of our valued clients via our robust production facilities, supported distribution network... Детальніше »
- Обладнання для друку та дизайну графічного
- Amritsar
- Індія
supplyautonomy.com/carmelengineering.in
We are manufacturer, supplier and exporter of flexo printing machinery such as flexographic printing machine and apart from this we also deals into non woven printing machine, lamination machine,... Детальніше »
- Обладнання для друку та дизайну графічного
- Madurai
- Індія
supplyautonomy.com/universalinksvarnishplimited.in
In the field of Inks & Varnish, we 'Universal Inks & Varnish (P) Ltd.' are leading the market since 1981 as a renowned manufacturer, exporter, importer and supplier. Our company has... Детальніше »
- Обладнання для друку та дизайну графічного | Друкована і споріднена продукція | Друкарська фарба і фарба сировини...
- Delhi
- Індія
supplyautonomy.com/ramanindustries.in
In the year of 1971 the company was established and engaged itself as a paper converterand susequently in the year of 1973 it had started Machine manufacturing unit. Now-a-days it has covered area... Детальніше »
- Пластикові ламінатори | Обладнання для друку та дизайну графічного...
- Kolkata
- Індія
supplyautonomy.com/msenterprises20.in
To offer a comprehensive product line meeting the engineering needs of our clients, M.S. Enterprises was established in the year 1975. We are renowned in the industry as leading Manufacturer,... Детальніше »
- Обладнання для друку та дизайну графічного
- Faridabad
- Індія
supplyautonomy.com/asindustrialconsultingservices.in
Catering a range of integrated technical consultancy services to a varied range of industrial houses for setting up new projects in India or abroad...A.S. Industrial Consulting Services, thereafter... Детальніше »
- Обладнання для друку та дизайну графічного
- Gurgaon
- Індія
supplyautonomy.com/ruiancambridgemachinery.cn
Located in RUIAN, the well-known Soft Package City of China, Ruian CAMBRIDGE MACHINE I/E Company pours big energy in package machinery. In 2008, we got the foot in manufacturing of Plastic Film... Детальніше »
- Механізм виготовлення сумки | Обладнання для друку та дизайну графічного...
- Ruian
- Китай
supplyautonomy.com/marsonsprintgrafmachinespvt.in
- Клеї й стрічки | Обладнання для друку та дизайну графічного | Глибокі друкарські машини | Пакувальне обладнання | Фольга...
- Mumbai
- Індія