نتائج البحث عن: الطباعة والمعدات الرسومات
الشركات وجدت 277supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... إقرأ المزيد »
- ماكينة صنع الحقائب | الطباعة والمعدات الرسومات
- Ruian
- الصين
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... إقرأ المزيد »
- الطباعة والمعدات الرسومات | معدات مناولة المواد الأخري
- Wenzhou
- الصين
supplyautonomy.com/acmemachinerycompanypvt.in
Into Manufacturing of Paper Corrugated Carton Production Line, print finishing machines since last three decades with excellent customer base using range of our machine.
The state of art... إقرأ المزيد »
- الطباعة والمعدات الرسومات | آلات التعبئة والتغليف
- Mumbai
- الهند
supplyautonomy.com/siadgroupsrl.it
SIAD GROUP srl provides end to end solutions for the new business of printing. We provide services and products including consulting, workflow and finishing printing equipment to match the... إقرأ المزيد »
- رقاقة الختم الساخنة | الطباعة والمعدات الرسومات
- Arese
- إيطاليا
supplyautonomy.com/ishaninternational.in
we leading manufacturer of plastic printing machine and bag making machines viz., Rotogravure Printing Machine, Flexo Printing Machine, Bag making machine, side sealing machine, Slitting... إقرأ المزيد »
- ماكينة صنع الحقائب | الطباعة والمعدات الرسومات
- Ahmedabad
- الهند
supplyautonomy.com/junsheng.cn
Our company is located in Dongguang County, Hebei Province, China. We are specialized in manufacturing all kinds of water base ink printing slotting die-cutting machines and whole sets of carton... إقرأ المزيد »
- معدات التنظيف | الطباعة والمعدات الرسومات | آلات التعبئة والتغليف | معدات تغليف مساعدة...
- Cangzhou
- الصين
supplyautonomy.com/zhejiangtianfengplasticmachineryplant.cn
Zhejiang Tianfeng Plastic Machinery Plant is a global supplier of standard and custom-engineered products and systems. Our products serve the complete range of PP/PE woven bag machine, leno mesh bag... إقرأ المزيد »
- ماكينة صنع الحقائب | الطباعة والمعدات الرسومات
- Wenzhou
- الصين
supplyautonomy.com/vishvaeximpvt.in
Manufacturer and Exporters of Roto Gravure Printing Machine, Flexo Graph Printing Machine, Laminators (Solvent less), Laminators (Base), Extrusion Machines, Small Packaging Machinery, Core Cutting... إقرأ المزيد »
- مهاوي | ﻣﻋﺩﺍﺗ ﺍﻟﺗﻟﻛﺳ | الطباعة والمعدات الرسومات | آلات التعبئة والتغليف...
- Ahmedabad
- الهند
supplyautonomy.com/shanghaipripackmachineryco.cn
Shanghai Pripack Machinery Co., Ltd. is a company that specializes in providing printing & packaging machinery and production line. Owning experienced employees and cooperating with many... إقرأ المزيد »
- خلائط الألمنيوم | الطباعة والمعدات الرسومات | آلات التعبئة والتغليف...
- Shanghai
- الصين
supplyautonomy.com/bajajprintpackmachineriespvt.in
We supply hologram Machinery to produce holograms from hologram master shooting to die-cutting, includes hologram master shooting system (2D / 3D master and Dot-matrix master) , recombination... إقرأ المزيد »
- ماكينات الملابس الأخري | الطباعة والمعدات الرسومات | آلات التعبئة والتغليف...
- New Delhi
- الهند
supplyautonomy.com/mmmauenhandelsgesellschaftmbh.de
MMM established in 1986 are specialists in matches industry.
Combination of integrity, high business ethics with sound consulatation, makes us your number one souce in Match Machinery and Material... إقرأ المزيد »
- الطباعة والمعدات الرسومات | آلات مستخدمة أخرى | تبغ وأدوات مدخنين
- Hamburg
- ألمانيا
supplyautonomy.com/natrajcorrugatingmachinerycompany.in
India's leading manufacturer and exporter of paper corrugated board and box making machinery since1955,Brand SUPER NATARAJA FORMERLY KNOWN AS NATARAJA. company have the experience of making... إقرأ المزيد »
- الطباعة والمعدات الرسومات | معدات مناولة المواد الأخري | آلات التعبئة والتغليف...
- New Delhi
- الهند
supplyautonomy.com/seniormachineryco.in
About Us
Promoted by a Team of qualified professionals. Highly experienced in the machinery filed.
We are 25 years old, out of which 15 years we were manufacturing Printing related... إقرأ المزيد »
- الطباعة والمعدات الرسومات | قطع غيار ماكينات تجهيز الأوراق | آلات التعبئة والتغليف...
- Pune
- الهند
supplyautonomy.com/alphagraphics737.us
At Alphagraphics 737 Grapevine, TX we have the skills and tools to help brand your company effectively. Call us for printing services, blueprint, car wraps, signs and banners.
- محطات العمل الرسومات | الطباعة والمعدات الرسومات | نسخ المخططات، آلات | الطابعات والمجلدات...
- Grapevine
- الولايات المتحدة
supplyautonomy.com/webcoindustries.in
supplyautonomy.com/lapraco.in
For more than 38 years, Lapra Co. has been constantly demonstrating its innovative
power and is today one of the leading companies in the area of flexible packaging
Our passion for ... إقرأ المزيد »
- الطباعة والمعدات الرسومات | آلة طباعة التصوير الروتوغرافي
- New Delhi
- الهند
supplyautonomy.com/multipresssrl.it
- ختم البلاستيك، آلات | حقن البلاستيك، آلات | مواد بلاستيكية، آلات صناعية | الطباعة والمعدات الرسومات...
- Ponte San Marco
- إيطاليا
supplyautonomy.com/urstechnologyofindia.in
Breaking new grounds in the domain of printers and allied machines, we, URS Technology Of India, have captured a huge market share. Our products are of high quality and meet the industrial quality... إقرأ المزيد »
- الطباعة والمعدات الرسومات | حبر الطباعة والمواد الخام الطلاء
- Kolkata
- الهند
supplyautonomy.com/suntrading.in
supplyautonomy.com/kptechmachineindiapvt.in
- أقمشة | حقائب | محافظ | الطباعة والمعدات الرسومات | معدات لحام | غير المنسوجة النسيج...
- Ahmedabad
- الهند
supplyautonomy.com/hicmachineryco.in
- الأنظمة الإلكترونية | الطباعة والمعدات الرسومات | آلات التعبئة والتغليف | الطابعات والمجلدات...
- Amritsar
- الهند
supplyautonomy.com/chinacangzhoujiajiamachinerymanufacture.cn
- ﺃﺩﻭﺍﺗ ﺍﻟﺑﻧﺍﺋﻳﻧ | ﻣﻋﺩﺍﺗ ﻛﻫﺭﺑﺍﺋﻳﺓ ﻭﻊﻟﻛﺗﺭﻭﻧﻳﺓ ﻟﻟﺳﻳﺍﺭﺍﺗ | الطباعة والمعدات الرسومات | مماسك (قلوب تشكيل) وغربان ذيل (مخارط)...
- Cangzhou
- الصين
supplyautonomy.com/babrahindustrialcorporation.in
About Babrah Industrial CorporationWe, Babrah Industrial Corporation, are meeting the bulk and urgent orders of our valued clients via our robust production facilities, supported distribution network... إقرأ المزيد »
- الطباعة والمعدات الرسومات
- Amritsar
- الهند
supplyautonomy.com/carmelengineering.in
We are manufacturer, supplier and exporter of flexo printing machinery such as flexographic printing machine and apart from this we also deals into non woven printing machine, lamination machine,... إقرأ المزيد »
- الطباعة والمعدات الرسومات
- Madurai
- الهند
supplyautonomy.com/universalinksvarnishplimited.in
In the field of Inks & Varnish, we 'Universal Inks & Varnish (P) Ltd.' are leading the market since 1981 as a renowned manufacturer, exporter, importer and supplier. Our company has... إقرأ المزيد »
- الطباعة والمعدات الرسومات | المطبوعات والمنتجات ذات الصلة | حبر الطباعة والمواد الخام الطلاء...
- Delhi
- الهند
supplyautonomy.com/ramanindustries.in
In the year of 1971 the company was established and engaged itself as a paper converterand susequently in the year of 1973 it had started Machine manufacturing unit. Now-a-days it has covered area... إقرأ المزيد »
- ماكينات تصفح البلاستيك | الطباعة والمعدات الرسومات
- Kolkata
- الهند
supplyautonomy.com/msenterprises20.in
To offer a comprehensive product line meeting the engineering needs of our clients, M.S. Enterprises was established in the year 1975. We are renowned in the industry as leading Manufacturer,... إقرأ المزيد »
- الطباعة والمعدات الرسومات
- Faridabad
- الهند
supplyautonomy.com/asindustrialconsultingservices.in
Catering a range of integrated technical consultancy services to a varied range of industrial houses for setting up new projects in India or abroad...A.S. Industrial Consulting Services, thereafter... إقرأ المزيد »
- الطباعة والمعدات الرسومات
- Gurgaon
- الهند
supplyautonomy.com/ruiancambridgemachinery.cn
Located in RUIAN, the well-known Soft Package City of China, Ruian CAMBRIDGE MACHINE I/E Company pours big energy in package machinery. In 2008, we got the foot in manufacturing of Plastic Film... إقرأ المزيد »
- ماكينة صنع الحقائب | الطباعة والمعدات الرسومات
- Ruian
- الصين
supplyautonomy.com/marsonsprintgrafmachinespvt.in
- مواد لاصقة والشريط | الطباعة والمعدات الرسومات | آلة طباعة التصوير الروتوغرافي | آلات التعبئة والتغليف | رقائق ختم...
- Mumbai
- الهند