에 대한 검색 결과 : 인쇄 및 그래픽 장비

발견 277 회사


supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... 자세히보기 »
  • 가방 기계 만들기 | 인쇄 및 그래픽 장비
  • Ruian
  • 중국
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... 자세히보기 »
  • 인쇄 및 그래픽 장비 | 기타 자료 처리 장비
  • Wenzhou
  • 중국
supplyautonomy.com/acmemachinerycompanypvt.in
Into Manufacturing of Paper Corrugated Carton Production Line, print finishing machines since last three decades with excellent customer base using range of our machine. The state of art... 자세히보기 »
  • 인쇄 및 그래픽 장비 | 포장 기계
  • Mumbai
  • 인도
supplyautonomy.com/siadgroupsrl.it
SIAD GROUP srl provides end to end solutions for the new business of printing. We provide services and products including consulting, workflow and finishing printing equipment to match the... 자세히보기 »
  • 뜨거운 플러레을 스탬프 | 인쇄 및 그래픽 장비
  • Arese
  • 이탈리아
supplyautonomy.com/ishaninternational.in
we leading manufacturer of plastic printing machine and bag making machines viz., Rotogravure Printing Machine, Flexo Printing Machine, Bag making machine, side sealing machine, Slitting... 자세히보기 »
  • 가방 기계 만들기 | 인쇄 및 그래픽 장비
  • Ahmedabad
  • 인도
supplyautonomy.com/junsheng.cn
Our company is located in Dongguang County, Hebei Province, China. We are specialized in manufacturing all kinds of water base ink printing slotting die-cutting machines and whole sets of carton... 자세히보기 »
  • 세척 장비 | 인쇄 및 그래픽 장비 | 포장 기계 | 보조 포장 장비
  • Cangzhou
  • 중국
supplyautonomy.com/zhejiangtianfengplasticmachineryplant.cn
Zhejiang Tianfeng Plastic Machinery Plant is a global supplier of standard and custom-engineered products and systems. Our products serve the complete range of PP/PE woven bag machine, leno mesh bag... 자세히보기 »
  • 가방 기계 만들기 | 인쇄 및 그래픽 장비
  • Wenzhou
  • 중국
supplyautonomy.com/vishvaeximpvt.in
Manufacturer and Exporters of Roto Gravure Printing Machine, Flexo Graph Printing Machine, Laminators (Solvent less), Laminators (Base), Extrusion Machines, Small Packaging Machinery, Core Cutting... 자세히보기 »
  • 샤프트 | 텔렉스 장비 | 인쇄 및 그래픽 장비 | 포장 기계
  • Ahmedabad
  • 인도
supplyautonomy.com/shanghaipripackmachineryco.cn
Shanghai Pripack Machinery Co., Ltd. is a company that specializes in providing printing & packaging machinery and production line. Owning experienced employees and cooperating with many... 자세히보기 »
  • 알루미늄 합금 | 인쇄 및 그래픽 장비 | 포장 기계
  • Shanghai
  • 중국
supplyautonomy.com/bajajprintpackmachineriespvt.in
We supply hologram Machinery to produce holograms from hologram master shooting to die-cutting, includes hologram master shooting system (2D / 3D master and Dot-matrix master) , recombination... 자세히보기 »
  • 기타 의류 기계 | 인쇄 및 그래픽 장비 | 포장 기계
  • New Delhi
  • 인도
supplyautonomy.com/mmmauenhandelsgesellschaftmbh.de
MMM established in 1986 are specialists in matches industry. Combination of integrity, high business ethics with sound consulatation, makes us your number one souce in Match Machinery and Material... 자세히보기 »
  • 인쇄 및 그래픽 장비 | 기타 중고 기계 | 담배와 흡연자 항목
  • Hamburg
  • 독일
supplyautonomy.com/natrajcorrugatingmachinerycompany.in
India's leading manufacturer and exporter of paper corrugated board and box making machinery since1955,Brand SUPER NATARAJA FORMERLY KNOWN AS NATARAJA. company have the experience of making... 자세히보기 »
  • 인쇄 및 그래픽 장비 | 기타 자료 처리 장비 | 포장 기계
  • New Delhi
  • 인도
supplyautonomy.com/seniormachineryco.in
About Us Promoted by a Team of qualified professionals. Highly experienced in the machinery filed. We are 25 years old, out of which 15 years we were manufacturing Printing related... 자세히보기 »
  • 인쇄 및 그래픽 장비 | 종이 가공 기계 부품 | 포장 기계
  • Pune
  • 인도
supplyautonomy.com/alphagraphics737.us
At Alphagraphics 737 Grapevine, TX we have the skills and tools to help brand your company effectively. Call us for printing services, blueprint, car wraps, signs and banners.
  • 그래픽 워크 스테이션 | 인쇄 및 그래픽 장비 | 청사진 - 복사 기계 | 프린터 및 바인더
  • Grapevine
  • 미국
supplyautonomy.com/webcoindustries.in
  • 인쇄 및 그래픽 장비 | 오프셋 프린터
  • Faridabad
  • 인도
supplyautonomy.com/lapraco.in
For more than 38 years, Lapra Co. has been constantly demonstrating its innovative power and is today one of the leading companies in the area of flexible packaging Our passion for ... 자세히보기 »
  • 인쇄 및 그래픽 장비 | 윤전 그라비어 인쇄 기계
  • New Delhi
  • 인도
supplyautonomy.com/multipresssrl.it
  • 스탬핑, 플라스틱 - 기계 | 사출, 플라스틱 - 기계 | 플라스틱 - 산업 기계 및 장비 | 인쇄 및 그래픽 장비...
  • Ponte San Marco
  • 이탈리아
supplyautonomy.com/urstechnologyofindia.in
Breaking new grounds in the domain of printers and allied machines, we, URS Technology Of India, have captured a huge market share. Our products are of high quality and meet the industrial quality... 자세히보기 »
  • 인쇄 및 그래픽 장비 | 인쇄 잉크 및 페인트 원료
  • Kolkata
  • 인도
supplyautonomy.com/suntrading.in
  • 가방 | 지갑 | 인쇄 및 그래픽 장비 | 오프셋 프린터 | 비 길쌈 된 직물
  • Chennai
  • 인도
supplyautonomy.com/kptechmachineindiapvt.in
  • 직물 | 가방 | 지갑 | 인쇄 및 그래픽 장비 | 용접 장비 | 비 길쌈 된 직물
  • Ahmedabad
  • 인도
supplyautonomy.com/hicmachineryco.in
  • 전자 공급 | 인쇄 및 그래픽 장비 | 포장 기계 | 프린터 및 바인더
  • Amritsar
  • 인도
supplyautonomy.com/chinacangzhoujiajiamachinerymanufacture.cn
  • 건설사 도구 | 자동차 전기 및 전자 장비 | 인쇄 및 그래픽 장비 | 굴대와 tailstocks
  • Cangzhou
  • 중국
supplyautonomy.com/babrahindustrialcorporation.in
About Babrah Industrial CorporationWe, Babrah Industrial Corporation, are meeting the bulk and urgent orders of our valued clients via our robust production facilities, supported distribution network... 자세히보기 »
  • 인쇄 및 그래픽 장비
  • Amritsar
  • 인도
supplyautonomy.com/carmelengineering.in
We are manufacturer, supplier and exporter of flexo printing machinery such as flexographic printing machine and apart from this we also deals into non woven printing machine, lamination machine,... 자세히보기 »
  • 인쇄 및 그래픽 장비
  • Madurai
  • 인도
supplyautonomy.com/universalinksvarnishplimited.in
In the field of Inks & Varnish, we 'Universal Inks & Varnish (P) Ltd.' are leading the market since 1981 as a renowned manufacturer, exporter, importer and supplier. Our company has... 자세히보기 »
  • 인쇄 및 그래픽 장비 | 인쇄물 및 관련 제품 | 인쇄 잉크 및 페인트 원료
  • Delhi
  • 인도
supplyautonomy.com/ramanindustries.in
In the year of 1971 the company was established and engaged itself as a paper converterand susequently in the year of 1973 it had started Machine manufacturing unit. Now-a-days it has covered area... 자세히보기 »
  • 플라스틱 코팅기 | 인쇄 및 그래픽 장비
  • Kolkata
  • 인도
supplyautonomy.com/msenterprises20.in
To offer a comprehensive product line meeting the engineering needs of our clients, M.S. Enterprises was established in the year 1975. We are renowned in the industry as leading Manufacturer,... 자세히보기 »
  • 인쇄 및 그래픽 장비
  • Faridabad
  • 인도
supplyautonomy.com/asindustrialconsultingservices.in
Catering a range of integrated technical consultancy services to a varied range of industrial houses for setting up new projects in India or abroad...A.S. Industrial Consulting Services, thereafter... 자세히보기 »
  • 인쇄 및 그래픽 장비
  • Gurgaon
  • 인도
supplyautonomy.com/ruiancambridgemachinery.cn
Located in RUIAN, the well-known Soft Package City of China, Ruian CAMBRIDGE MACHINE I/E Company pours big energy in package machinery. In 2008, we got the foot in manufacturing of Plastic Film... 자세히보기 »
  • 가방 기계 만들기 | 인쇄 및 그래픽 장비
  • Ruian
  • 중국
supplyautonomy.com/marsonsprintgrafmachinespvt.in
  • 접착제 및 테이프 | 인쇄 및 그래픽 장비 | 윤전 그라비어 인쇄 기계 | 포장 기계 | 스탬핑 포일...
  • Mumbai
  • 인도