Loading...
Search Results for: Printing and graphics equipment
Found 277 companiessupplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Read More »
- Bag making machinery | Printing and graphics equipment
- Ruian
- China
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Read More »
- Printing and graphics equipment | Other material handling equipment
- Wenzhou
- China
supplyautonomy.com/acmemachinerycompanypvt.in
Into Manufacturing of Paper Corrugated Carton Production Line, print finishing machines since last three decades with excellent customer base using range of our machine.
The state of art... Read More »
- Printing and graphics equipment | Packaging machinery
- Mumbai
- India
supplyautonomy.com/siadgroupsrl.it
SIAD GROUP srl provides end to end solutions for the new business of printing. We provide services and products including consulting, workflow and finishing printing equipment to match the... Read More »
- Hot stamping foil | Printing and graphics equipment
- Arese
- Italy
supplyautonomy.com/ishaninternational.in
we leading manufacturer of plastic printing machine and bag making machines viz., Rotogravure Printing Machine, Flexo Printing Machine, Bag making machine, side sealing machine, Slitting... Read More »
- Bag making machinery | Printing and graphics equipment
- Ahmedabad
- India
supplyautonomy.com/junsheng.cn
Our company is located in Dongguang County, Hebei Province, China. We are specialized in manufacturing all kinds of water base ink printing slotting die-cutting machines and whole sets of carton... Read More »
- Cleaning equipment | Printing and graphics equipment | Packaging machinery | Auxiliary packaging equipment
- Cangzhou
- China
supplyautonomy.com/zhejiangtianfengplasticmachineryplant.cn
Zhejiang Tianfeng Plastic Machinery Plant is a global supplier of standard and custom-engineered products and systems. Our products serve the complete range of PP/PE woven bag machine, leno mesh bag... Read More »
- Bag making machinery | Printing and graphics equipment
- Wenzhou
- China
supplyautonomy.com/vishvaeximpvt.in
Manufacturer and Exporters of Roto Gravure Printing Machine, Flexo Graph Printing Machine, Laminators (Solvent less), Laminators (Base), Extrusion Machines, Small Packaging Machinery, Core Cutting... Read More »
- Shafts | Telex equipment | Printing and graphics equipment | Packaging machinery
- Ahmedabad
- India
supplyautonomy.com/shanghaipripackmachineryco.cn
Shanghai Pripack Machinery Co., Ltd. is a company that specializes in providing printing & packaging machinery and production line. Owning experienced employees and cooperating with many... Read More »
- Aluminium alloys | Printing and graphics equipment | Packaging machinery
- Shanghai
- China
supplyautonomy.com/bajajprintpackmachineriespvt.in
We supply hologram Machinery to produce holograms from hologram master shooting to die-cutting, includes hologram master shooting system (2D / 3D master and Dot-matrix master) , recombination... Read More »
- Other apparel machinery | Printing and graphics equipment | Packaging machinery
- New Delhi
- India
supplyautonomy.com/mmmauenhandelsgesellschaftmbh.de
MMM established in 1986 are specialists in matches industry.
Combination of integrity, high business ethics with sound consulatation, makes us your number one souce in Match Machinery and Material... Read More »
- Printing and graphics equipment | Other used machinery | Tobacco and smokers items
- Hamburg
- Germany
supplyautonomy.com/natrajcorrugatingmachinerycompany.in
India's leading manufacturer and exporter of paper corrugated board and box making machinery since1955,Brand SUPER NATARAJA FORMERLY KNOWN AS NATARAJA. company have the experience of making... Read More »
- Printing and graphics equipment | Other material handling equipment | Packaging machinery
- New Delhi
- India
supplyautonomy.com/seniormachineryco.in
About Us
Promoted by a Team of qualified professionals. Highly experienced in the machinery filed.
We are 25 years old, out of which 15 years we were manufacturing Printing related... Read More »
- Printing and graphics equipment | Paper processing machinery parts | Packaging machinery
- Pune
- India
supplyautonomy.com/alphagraphics737.us
At Alphagraphics 737 Grapevine, TX we have the skills and tools to help brand your company effectively. Call us for printing services, blueprint, car wraps, signs and banners.
- Graphics workstations | Printing and graphics equipment | Blueprint-copying machinery | Printers & binders
- Grapevine
- United States
supplyautonomy.com/webcoindustries.in
supplyautonomy.com/lapraco.in
For more than 38 years, Lapra Co. has been constantly demonstrating its innovative
power and is today one of the leading companies in the area of flexible packaging
Our passion for ... Read More »
- Printing and graphics equipment | Rotogravure printing machine
- New Delhi
- India
supplyautonomy.com/multipresssrl.it
- Stamping, plastics - machinery | Injection, plastics - machinery | Plastics - industrial machinery and equipment |...
- Ponte San Marco
- Italy
supplyautonomy.com/urstechnologyofindia.in
Breaking new grounds in the domain of printers and allied machines, we, URS Technology Of India, have captured a huge market share. Our products are of high quality and meet the industrial quality... Read More »
- Printing and graphics equipment | Printing ink & paint raw material
- Kolkata
- India
supplyautonomy.com/suntrading.in
supplyautonomy.com/kptechmachineindiapvt.in
- Fabrics | Bags | Wallets | Printing and graphics equipment | Welding equipment | Non woven fabric
- Ahmedabad
- India
supplyautonomy.com/hicmachineryco.in
- Electronic supplies | Printing and graphics equipment | Packaging machinery | Printers & binders
- Amritsar
- India
supplyautonomy.com/chinacangzhoujiajiamachinerymanufacture.cn
- Builders' tools | Motor vehicle electrical and electronic equipment | Printing and graphics equipment | Mandrels and...
- Cangzhou
- China
supplyautonomy.com/babrahindustrialcorporation.in
About Babrah Industrial CorporationWe, Babrah Industrial Corporation, are meeting the bulk and urgent orders of our valued clients via our robust production facilities, supported distribution network... Read More »
- Printing and graphics equipment
- Amritsar
- India
supplyautonomy.com/carmelengineering.in
We are manufacturer, supplier and exporter of flexo printing machinery such as flexographic printing machine and apart from this we also deals into non woven printing machine, lamination machine,... Read More »
- Printing and graphics equipment
- Madurai
- India
supplyautonomy.com/universalinksvarnishplimited.in
In the field of Inks & Varnish, we 'Universal Inks & Varnish (P) Ltd.' are leading the market since 1981 as a renowned manufacturer, exporter, importer and supplier. Our company has... Read More »
- Printing and graphics equipment | Printed matter and related products | Printing ink & paint raw material
- Delhi
- India
supplyautonomy.com/ramanindustries.in
In the year of 1971 the company was established and engaged itself as a paper converterand susequently in the year of 1973 it had started Machine manufacturing unit. Now-a-days it has covered area... Read More »
- Plastic laminating machinery | Printing and graphics equipment
- Kolkata
- India
supplyautonomy.com/msenterprises20.in
To offer a comprehensive product line meeting the engineering needs of our clients, M.S. Enterprises was established in the year 1975. We are renowned in the industry as leading Manufacturer,... Read More »
- Printing and graphics equipment
- Faridabad
- India
supplyautonomy.com/asindustrialconsultingservices.in
Catering a range of integrated technical consultancy services to a varied range of industrial houses for setting up new projects in India or abroad...A.S. Industrial Consulting Services, thereafter... Read More »
- Printing and graphics equipment
- Gurgaon
- India
supplyautonomy.com/ruiancambridgemachinery.cn
Located in RUIAN, the well-known Soft Package City of China, Ruian CAMBRIDGE MACHINE I/E Company pours big energy in package machinery. In 2008, we got the foot in manufacturing of Plastic Film... Read More »
- Bag making machinery | Printing and graphics equipment
- Ruian
- China
supplyautonomy.com/marsonsprintgrafmachinespvt.in
- Adhesives and tape | Printing and graphics equipment | Rotogravure printing machine | Packaging machinery | Stamping...
- Mumbai
- India