Вынікі пошуку для: Абсталяванне для друку і дызайну графічнага

Знойдзеныя 277 кампаніі


supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Больш падрабязна »
  • Механізм вырабу сумкі | Абсталяванне для друку і дызайну графічнага...
  • Ruian
  • Кітай
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Больш падрабязна »
  • Абсталяванне для друку і дызайну графічнага | Іншае абсталяванне апрацоўкі матэрыялаў...
  • Wenzhou
  • Кітай
supplyautonomy.com/acmemachinerycompanypvt.in
Into Manufacturing of Paper Corrugated Carton Production Line, print finishing machines since last three decades with excellent customer base using range of our machine. The state of art... Больш падрабязна »
  • Абсталяванне для друку і дызайну графічнага | Ўпаковачная абсталяванне...
  • Mumbai
  • Індыя
supplyautonomy.com/siadgroupsrl.it
SIAD GROUP srl provides end to end solutions for the new business of printing. We provide services and products including consulting, workflow and finishing printing equipment to match the... Больш падрабязна »
  • Тэрмічная фальга | Абсталяванне для друку і дызайну графічнага
  • Arese
  • Італія
supplyautonomy.com/ishaninternational.in
we leading manufacturer of plastic printing machine and bag making machines viz., Rotogravure Printing Machine, Flexo Printing Machine, Bag making machine, side sealing machine, Slitting... Больш падрабязна »
  • Механізм вырабу сумкі | Абсталяванне для друку і дызайну графічнага...
  • Ahmedabad
  • Індыя
supplyautonomy.com/junsheng.cn
Our company is located in Dongguang County, Hebei Province, China. We are specialized in manufacturing all kinds of water base ink printing slotting die-cutting machines and whole sets of carton... Больш падрабязна »
  • Абсталяванне для ачысткі | Абсталяванне для друку і дызайну графічнага | Ўпаковачная абсталяванне | Дапаможнае ўпаковачн...
  • Cangzhou
  • Кітай
supplyautonomy.com/zhejiangtianfengplasticmachineryplant.cn
Zhejiang Tianfeng Plastic Machinery Plant is a global supplier of standard and custom-engineered products and systems. Our products serve the complete range of PP/PE woven bag machine, leno mesh bag... Больш падрабязна »
  • Механізм вырабу сумкі | Абсталяванне для друку і дызайну графічнага...
  • Wenzhou
  • Кітай
supplyautonomy.com/vishvaeximpvt.in
Manufacturer and Exporters of Roto Gravure Printing Machine, Flexo Graph Printing Machine, Laminators (Solvent less), Laminators (Base), Extrusion Machines, Small Packaging Machinery, Core Cutting... Больш падрабязна »
  • Валы | Тэлекснай абсталяванне | Абсталяванне для друку і дызайну графічнага | Ўпаковачная абсталяванне...
  • Ahmedabad
  • Індыя
supplyautonomy.com/shanghaipripackmachineryco.cn
Shanghai Pripack Machinery Co., Ltd. is a company that specializes in providing printing & packaging machinery and production line. Owning experienced employees and cooperating with many... Больш падрабязна »
  • Алюмініевыя сплавы | Абсталяванне для друку і дызайну графічнага | Ўпаковачная абсталяванне...
  • Shanghai
  • Кітай
supplyautonomy.com/bajajprintpackmachineriespvt.in
We supply hologram Machinery to produce holograms from hologram master shooting to die-cutting, includes hologram master shooting system (2D / 3D master and Dot-matrix master) , recombination... Больш падрабязна »
  • Іншыя швейныя машыны | Абсталяванне для друку і дызайну графічнага | Ўпаковачная абсталяванне...
  • New Delhi
  • Індыя
supplyautonomy.com/mmmauenhandelsgesellschaftmbh.de
MMM established in 1986 are specialists in matches industry. Combination of integrity, high business ethics with sound consulatation, makes us your number one souce in Match Machinery and Material... Больш падрабязна »
  • Абсталяванне для друку і дызайну графічнага | Іншыя выкарыстаныя механізмы | Тытунь, тавары для тых, хто паліць...
  • Hamburg
  • Германія
supplyautonomy.com/natrajcorrugatingmachinerycompany.in
India's leading manufacturer and exporter of paper corrugated board and box making machinery since1955,Brand SUPER NATARAJA FORMERLY KNOWN AS NATARAJA. company have the experience of making... Больш падрабязна »
  • Абсталяванне для друку і дызайну графічнага | Іншае абсталяванне апрацоўкі матэрыялаў | Ўпаковачная абсталяванне...
  • New Delhi
  • Індыя
supplyautonomy.com/seniormachineryco.in
About Us Promoted by a Team of qualified professionals. Highly experienced in the machinery filed. We are 25 years old, out of which 15 years we were manufacturing Printing related... Больш падрабязна »
  • Абсталяванне для друку і дызайну графічнага | Часткі машыны апрацоўкі папяровых прадуктаў | Ўпаковачная абсталяванне...
  • Pune
  • Індыя
supplyautonomy.com/alphagraphics737.us
At Alphagraphics 737 Grapevine, TX we have the skills and tools to help brand your company effectively. Call us for printing services, blueprint, car wraps, signs and banners.
  • Аўтаматызаваных працоўных месцаў для графічных дызайнераў | Абсталяванне для друку і дызайну графічнага | Светокопировал...
  • Grapevine
  • Злучаныя Штаты
supplyautonomy.com/webcoindustries.in
  • Абсталяванне для друку і дызайну графічнага | Машыны афсетнага друку...
  • Faridabad
  • Індыя
supplyautonomy.com/lapraco.in
For more than 38 years, Lapra Co. has been constantly demonstrating its innovative power and is today one of the leading companies in the area of flexible packaging Our passion for ... Больш падрабязна »
  • Абсталяванне для друку і дызайну графічнага | Глыбокія друкаваныя машыны...
  • New Delhi
  • Індыя
supplyautonomy.com/multipresssrl.it
  • Ліставая штампоўка пластмас - абсталяванне | Ліццё пластмас пад ціскам - абсталяванне | Пластмасы - прамысловае абсталяв...
  • Ponte San Marco
  • Італія
supplyautonomy.com/urstechnologyofindia.in
Breaking new grounds in the domain of printers and allied machines, we, URS Technology Of India, have captured a huge market share. Our products are of high quality and meet the industrial quality... Больш падрабязна »
  • Абсталяванне для друку і дызайну графічнага | Друкаваная фарба і фарба сыравіны...
  • Kolkata
  • Індыя
supplyautonomy.com/suntrading.in
  • Сумкі і дарожныя аксэсуары | Кашалькі | Абсталяванне для друку і дызайну графічнага | Машыны афсетнага друку | Нятканыя ...
  • Chennai
  • Індыя
supplyautonomy.com/kptechmachineindiapvt.in
  • Тканіны | Сумкі і дарожныя аксэсуары | Кашалькі | Абсталяванне для друку і дызайну графічнага | Зварка | Нятканыя тканін...
  • Ahmedabad
  • Індыя
supplyautonomy.com/hicmachineryco.in
  • Электронныя аксэсуары | Абсталяванне для друку і дызайну графічнага | Ўпаковачная абсталяванне | Прынтэры і злучныя...
  • Amritsar
  • Індыя
supplyautonomy.com/chinacangzhoujiajiamachinerymanufacture.cn
  • Інструменты для будаўнічых работ | Электрычнае і электроннае абсталяванне аўтамабіляў і аўтатранспартных сродкаў | Абста...
  • Cangzhou
  • Кітай
supplyautonomy.com/babrahindustrialcorporation.in
About Babrah Industrial CorporationWe, Babrah Industrial Corporation, are meeting the bulk and urgent orders of our valued clients via our robust production facilities, supported distribution network... Больш падрабязна »
  • Абсталяванне для друку і дызайну графічнага
  • Amritsar
  • Індыя
supplyautonomy.com/carmelengineering.in
We are manufacturer, supplier and exporter of flexo printing machinery such as flexographic printing machine and apart from this we also deals into non woven printing machine, lamination machine,... Больш падрабязна »
  • Абсталяванне для друку і дызайну графічнага
  • Madurai
  • Індыя
supplyautonomy.com/universalinksvarnishplimited.in
In the field of Inks & Varnish, we 'Universal Inks & Varnish (P) Ltd.' are leading the market since 1981 as a renowned manufacturer, exporter, importer and supplier. Our company has... Больш падрабязна »
  • Абсталяванне для друку і дызайну графічнага | Друкаваная і роднасная прадукцыя | Друкаваная фарба і фарба сыравіны...
  • Delhi
  • Індыя
supplyautonomy.com/ramanindustries.in
In the year of 1971 the company was established and engaged itself as a paper converterand susequently in the year of 1973 it had started Machine manufacturing unit. Now-a-days it has covered area... Больш падрабязна »
  • Пластыкавыя ламінаторы | Абсталяванне для друку і дызайну графічнага...
  • Kolkata
  • Індыя
supplyautonomy.com/msenterprises20.in
To offer a comprehensive product line meeting the engineering needs of our clients, M.S. Enterprises was established in the year 1975. We are renowned in the industry as leading Manufacturer,... Больш падрабязна »
  • Абсталяванне для друку і дызайну графічнага
  • Faridabad
  • Індыя
supplyautonomy.com/asindustrialconsultingservices.in
Catering a range of integrated technical consultancy services to a varied range of industrial houses for setting up new projects in India or abroad...A.S. Industrial Consulting Services, thereafter... Больш падрабязна »
  • Абсталяванне для друку і дызайну графічнага
  • Gurgaon
  • Індыя
supplyautonomy.com/ruiancambridgemachinery.cn
Located in RUIAN, the well-known Soft Package City of China, Ruian CAMBRIDGE MACHINE I/E Company pours big energy in package machinery. In 2008, we got the foot in manufacturing of Plastic Film... Больш падрабязна »
  • Механізм вырабу сумкі | Абсталяванне для друку і дызайну графічнага...
  • Ruian
  • Кітай
supplyautonomy.com/marsonsprintgrafmachinespvt.in
  • Клеі і стужкі | Абсталяванне для друку і дызайну графічнага | Глыбокія друкаваныя машыны | Ўпаковачная абсталяванне | Фа...
  • Mumbai
  • Індыя