Search Results for: Solar products & equipment
Found 6324 companiessupplyautonomy.com/hincoopower.ph
Hincoo Power offers comprehensive solutions that hugely augment the peak power shortage, given the development of the local economy, industry, and commerce. It has supported the rapid growth of the... Read More »
- Power stations, solar energy | Solar power plant, photovoltaic cell | Modules | Solar trackers for photovoltaic panels...
- Shenzhen
- China
supplyautonomy.com/placasar1es.es
supplyautonomy.com/guangdongnamkoopowerco.cn
supplyautonomy.com/apexenterprises.in
You will pleased to know that we professional in setup second hand Rolling mill,Induction or Arc furnace, Industrial Machinery and electrical items such as all type of motors(DC AC),Turbines,water... Read More »
- Construction projects | Insulation materials | Builders' tools | Stationery | Wallets | Capping and overcapping...
- Secunderabad
- India
supplyautonomy.com/geospec.in
We are into business of providing turnkey solutions in Lighting Green Energy Solutions viz. Solar Wind energy solutions. We are operating in both Goverment as well as private sector have... Read More »
- Electrical components | Incandescent lamps | Lamps and floodlights, acetylene | Lamps, oil | Spirit lamps | Gas lamps |...
- Gurgaon
- India
supplyautonomy.com/indotechindustrialsolutionspvt.in
We are a diversified technology leader, providing integrated automation and software solutions to various industries like technology, power, service sector, mobile pstn line operators,... Read More »
- Milk powder | Telecommunications - equipment and systems | Electronic supplies | Electrical components | Electrical and...
- Pune
- India
supplyautonomy.com/yessolarsolutionscary.us
At Yes Solar Solutions, our unique advantage lies in our commitment to quality and the craftsmanship we bring to each project. We are the only NABCEP Accredited solar installer in North Carolina and... Read More »
- Solar energy panel installation | Solar panel roof-covering work | Solar panels | Solar panel | Solar products &...
- Cary
- United States
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Read More »
- Security product agents | Transfer printing | Injection moulding services, metal | Insulation materials | Custom design...
- Amravati
- India
supplyautonomy.com/laxmiindustries.in
Manufacturer and Exporters of Three Wheeler, Hand Operated Tricycles, Wheelchair, Walker, Crutches, Hearing Aids and Mopeds/Motor Cycles with Three Wheeler and Both Side Wheel Attachment System.
- Fabricators, aluminium | Builders' tools | Ball valves | Butterfly valves | Wheat | Medical furniture | Textile related...
- Indore
- India
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Read More »
- Security product agents | Transfer printing | Injection moulding services, metal | Insulation materials | Custom design...
- Mumbai
- India
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Read More »
- Security product agents | Transfer printing | Injection moulding services, metal | Insulation materials | Custom design...
- Faridabad
- India
supplyautonomy.com/china.cn
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade.
It has its offices at various places in India and has its global... Read More »
- Machine tow processing services | Textile waste processing services, wool | Textile waste processing services, hair |...
- Mumbai
- India
supplyautonomy.com/ronakgroup.in
Ronak Rocks Pvt. Ltd. is a professionally managed organization engaged in the production of a variety of stone products in various sizes and finishes. Our range of natural stone and natural building... Read More »
- Health projects | Apparel design services | Miscellaneous building stone | Electrical components | Battery packs |...
- Vadodara
- India
supplyautonomy.com/miplmanoharinternationalpvt.in
MIPL, one of the worlds most trusted brands, is a name with a long history that powers itself into new ventures. This trust extends to a series of products, services and solutions that cover diverse... Read More »
- Ball valves | Butterfly valves | Plastic products | Other packaging materials | Staples, wire | Quartz stone | Nuts |...
- Ahmedabad
- India
supplyautonomy.com/babaenterprises.in
Baba Enterprises is a name to reckon with the spectrum of latest garment accessories. The business avenues of our company comprises of manufacturing, supplying and exporting a wide range of apparel... Read More »
- Construction projects | Builders' tools | Furnishing | Ethnic garments | Fabrics | Garment rivets | Electrical...
- New Delhi
- India
supplyautonomy.com/basantproductsindia.in
INTRODUCTION
M / S Basant Products (India) is a prestigious award winner for quality Marketing and three BIS licenses holder, manufacturer and Exporter of Diesel Generating Sets, Diesel Engines,... Read More »
- Other agency services | Diesel generators | Electric motor | Food industry plant and equipment NES | Well-drilling...
- Agra
- India
supplyautonomy.com/citadelarchitecturalsolutionspvt.in
Citadel Architectural Solutions Pvt. Ltd., is an innovative company headquartered in Mumbai. Citadel works with a number of innovative roofing and cladding products and solutions, as well as... Read More »
- Air purifiers | Roof | Decorative high-pressure laminates / hpl | Plastic products | Plastic film | Electronic signs |...
- Mumbai
- India
supplyautonomy.com/scientechtechnologiespvt.in
Scientech Technologies Pvt. Ltd. is an ISO 9001:2008 certified company that has a strong presence in educational, health care, environmental and industrial sectors. With more than 550 diverse... Read More »
- Electrical and electronic products | Other power supplies | Industrial power supply | Well-drilling machinery |...
- Indore
- India
supplyautonomy.com/spaceagesecuritysystems.in
Spaceage Security Systems Ltd. is an exporter of India Solar Lamps products. With a well management system, Sisale strives to offer the best quality products and service as possible as we can, as... Read More »
- Telephone sets | Telecommunications - equipment and systems | Electronic components | Electronic supplies | Electrical...
- Delhi
- India
supplyautonomy.com/uniquecombustion.in
Company Brief Empowered with technological expertise and service support of a highly skilled workforce, we, Unique Combustion, have emerged as one of the leading manufacturers, exporters, importers,... Read More »
- Business travel packages | Boiler parts | Burners, industrial | Electric motor | Electrical and electronic equipment |...
- New Delhi
- India
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Read More »
- Security product agents | Transfer printing | Injection moulding services, metal | Insulation materials | Custom design...
- Ahmedabad
- India
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Read More »
- Security product agents | Transfer printing | Injection moulding services, metal | Insulation materials | Custom design...
- Bardoli
- India
supplyautonomy.com/jayagenciez.in
Jay Agenciez is an authorized agent in India for some of the worlds most famous Brands of Industrial Products. We are mainly into the Import and Export supplies of Industrial Consumables which are... Read More »
- Insulation materials | Cleaning equipment | Plastic products | Adhesives and tape | Welding equipment | Staples, wire |...
- Surat
- India
supplyautonomy.com/trademaxenterprise.in
TradeMax Enterprise has been founded by a team of professionals with rich experience in international business and Trading. Our team has worked for years in sourcing of products and... Read More »
- Carpets | Cable glands | Electric motor | Packaging machinery | Clothes | Coir products | Rubber & rubber products |...
- Mumbai
- India
supplyautonomy.com/ganpatielectricalspvt.in
Profile
Established in the year 1998, Ganpati Electricals Pvt. Ltd. is amongst the leading manufacturers and traders of wide range of electrical equipment. We specialize in Servo Voltage... Read More »
- Contractors to the electricity production and distribution industry | Other design services | Terminal blocks | Diesel...
- Delhi
- India
supplyautonomy.com/srisaienterprises.in
EXPORT PACKERS in Gujarat
QUALITY PACKERS/vinyl packers/anti corrosive packaging
DISTRIBUTOR OF Valvoline Cummins ltd. Tectyl products.
Industrial lubricants distributors
Polka dotted hand... Read More »
- Contractors to the electricity production and distribution industry | Courier services | Ball valves | Butterfly valves...
- Warangal
- India
supplyautonomy.com/crystalhomeappliancesindia.in
Ask it and you have it with CRYSTAL HOME APPLIANCES (INDIA) presenting a wide range of MLM products with guaranteed best price. We are one of the biggest names engaged in the domain of offering ... Read More »
- Custom software development services | Cleaning equipment | Non-alcoholic beverages | Fabrics | Wallets | Electrical...
- Jaipur
- India
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... Read More »
- Solar energy production | Solar energy consultants | Lithium accumulators | Solar products & equipment | Solar energy...
- Gurgaon
- India
supplyautonomy.com/zenithfilms.sg
At Zenith Window Films, we offer a spectrum of of 3m solar window films, 3m whiteboard films for home and window tinting in Singapore at cheap prices. We are dedicated to offer excellent service to... Read More »
- Solar products & equipment
- singapore
- Singapore