Результаты поиска для: Солнечные продукты и оборудование

Найдены 6324 компании


supplyautonomy.com/hincoopower.ph
Hincoo Power offers comprehensive solutions that hugely augment the peak power shortage, given the development of the local economy, industry, and commerce. It has supported the rapid growth of the... Подробнее »
  • Электростанции солнечные, гелиостанции | Электростанции солнечные (гелиоустановки), фотоэлектрические станции | Модули |...
  • Shenzhen
  • Китай
supplyautonomy.com/placasar1es.es
  • Услуги монтажа проводки для электротехнической промышленности | Термоизоляция для панелей солнечных батарей | Аккумулято...
  • Madrid
  • Испания
supplyautonomy.com/guangdongnamkoopowerco.cn
  • Производство электроэнергии | Электростанции солнечные, гелиостанции | Электростанции солнечные (гелиоустановки), фотоэл...
  • Foshan
  • Китай
supplyautonomy.com/apexenterprises.in
You will pleased to know that we professional in setup second hand Rolling mill,Induction or Arc furnace, Industrial Machinery and electrical items such as all type of motors(DC AC),Turbines,water... Подробнее »
  • Строительные проекты | Изоляционные материалы | Инструменты для строительных работ | Канцтовары | Кошельки | Колпачки из...
  • Secunderabad
  • Индия
supplyautonomy.com/geospec.in
We are into business of providing turnkey solutions in Lighting Green Energy Solutions viz. Solar Wind energy solutions. We are operating in both Goverment as well as private sector have... Подробнее »
  • Электрические компоненты | Лампа накаливания | Лампы и прожекторы ацетиленовые | Лампы керосиновые | Спиртовки, спиртовы...
  • Gurgaon
  • Индия
supplyautonomy.com/indotechindustrialsolutionspvt.in
We are a diversified technology leader, providing integrated automation and software solutions to various industries like technology, power, service sector, mobile pstn line operators,... Подробнее »
  • Сухое молоко | Телекоммуникации - системы и оборудование | Электронные аксессуары | Электрические компоненты | Электроте...
  • Pune
  • Индия
supplyautonomy.com/yessolarsolutionscary.us
At Yes Solar Solutions, our unique advantage lies in our commitment to quality and the craftsmanship we bring to each project. We are the only NABCEP Accredited solar installer in North Carolina and... Подробнее »
  • Устройству гелиоустановок, солнечных батарей для теплоснабжения зданий | Работы крышка крыши с солнечными батареями | Па...
  • Cary
  • США
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Подробнее »
  • Агенты по продуктам безопасности | переводная печать | Услуги литьевого формования металлов | Изоляционные материалы | П...
  • Amravati
  • Индия
supplyautonomy.com/laxmiindustries.in
Manufacturer and Exporters of Three Wheeler, Hand Operated Tricycles, Wheelchair, Walker, Crutches, Hearing Aids and Mopeds/Motor Cycles with Three Wheeler and Both Side Wheel Attachment System.
  • Услуги создания и заводского монтажа конструкций из алюминия | Инструменты для строительных работ | Краны с шаровым кран...
  • Indore
  • Индия
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Подробнее »
  • Агенты по продуктам безопасности | переводная печать | Услуги литьевого формования металлов | Изоляционные материалы | П...
  • Mumbai
  • Индия
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Подробнее »
  • Агенты по продуктам безопасности | переводная печать | Услуги литьевого формования металлов | Изоляционные материалы | П...
  • Faridabad
  • Индия
supplyautonomy.com/china.cn
Self-aligning ball bearings, ball bearings, spherical roller bearings, roller bearings, angular contact ball bearings, ball bearings, cylindrical.
  • Услуги литьевого формования металлов | Трубы, трубки, патрубки стальные | Оборудование для очистки | Инструменты для стр...
  • Hangzhou
  • Китай
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade. It has its offices at various places in India and has its global... Подробнее »
  • Услуги переработки машинных текстильных очесов | Услуги переработки текстильных шерстяных отходов | Услуги переработки т...
  • Mumbai
  • Индия
supplyautonomy.com/ronakgroup.in
Ronak Rocks Pvt. Ltd. is a professionally managed organization engaged in the production of a variety of stone products in various sizes and finishes. Our range of natural stone and natural building... Подробнее »
  • Проекты "Здоровье" | сервис по оформительскому дизайну | Разное каменное здание | Электрические компоненты | Группы бат...
  • Vadodara
  • Индия
supplyautonomy.com/miplmanoharinternationalpvt.in
MIPL, one of the worlds most trusted brands, is a name with a long history that powers itself into new ventures. This trust extends to a series of products, services and solutions that cover diverse... Подробнее »
  • Краны с шаровым краном | Поворотные затворы | Изделия из пластика | Другие упаковочные материалы | Скобы из проволоки | ...
  • Ahmedabad
  • Индия
supplyautonomy.com/babaenterprises.in
Baba Enterprises is a name to reckon with the spectrum of latest garment accessories. The business avenues of our company comprises of manufacturing, supplying and exporting a wide range of apparel... Подробнее »
  • Строительные проекты | Инструменты для строительных работ | Оборудование | Этнические Одежды | Ткани | Одежда с заклепка...
  • New Delhi
  • Индия
supplyautonomy.com/basantproductsindia.in
INTRODUCTION M / S Basant Products (India) is a prestigious award winner for quality Marketing and three BIS licenses holder, manufacturer and Exporter of Diesel Generating Sets, Diesel Engines,... Подробнее »
  • Другие услуги агентства | дизель-генератор | Электрические двигатели | Установки и оборудование для пищевой промышленнос...
  • Agra
  • Индия
supplyautonomy.com/citadelarchitecturalsolutionspvt.in
Citadel Architectural Solutions Pvt. Ltd., is an innovative company headquartered in Mumbai. Citadel works with a number of innovative roofing and cladding products and solutions, as well as... Подробнее »
  • Очиститель воздуха | Крыша | Декоративные пластинки высокого давления/HPL | Изделия из пластика | Полиэтиленовая пленка ...
  • Mumbai
  • Индия
supplyautonomy.com/scientechtechnologiespvt.in
Scientech Technologies Pvt. Ltd. is an ISO 9001:2008 certified company that has a strong presence in educational, health care, environmental and industrial sectors. With more than 550 diverse... Подробнее »
  • Электротехническая продукция и электронные приборы | Другие источники питания | Источники питания промышленного назначен...
  • Indore
  • Индия
supplyautonomy.com/spaceagesecuritysystems.in
Spaceage Security Systems Ltd. is an exporter of India Solar Lamps products. With a well management system, Sisale strives to offer the best quality products and service as possible as we can, as... Подробнее »
  • Телефонов | Телекоммуникации - системы и оборудование | Электронные компоненты | Электронные аксессуары | Электрические ...
  • Delhi
  • Индия
supplyautonomy.com/uniquecombustion.in
Company Brief Empowered with technological expertise and service support of a highly skilled workforce, we, Unique Combustion, have emerged as one of the leading manufacturers, exporters, importers,... Подробнее »
  • Пакет делового путешествия | Частей котла | Горелки промышленные | Электрические двигатели | Электротехническое и электр...
  • New Delhi
  • Индия
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Подробнее »
  • Агенты по продуктам безопасности | переводная печать | Услуги литьевого формования металлов | Изоляционные материалы | П...
  • Ahmedabad
  • Индия
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Подробнее »
  • Агенты по продуктам безопасности | переводная печать | Услуги литьевого формования металлов | Изоляционные материалы | П...
  • Bardoli
  • Индия
supplyautonomy.com/jayagenciez.in
Jay Agenciez is an authorized agent in India for some of the worlds most famous Brands of Industrial Products. We are mainly into the Import and Export supplies of Industrial Consumables which are... Подробнее »
  • Изоляционные материалы | Оборудование для очистки | Изделия из пластика | Клеи и ленты | Сварка | Скобы из проволоки | С...
  • Surat
  • Индия
supplyautonomy.com/trademaxenterprise.in
TradeMax Enterprise has been founded by a team of professionals with rich experience in international business and Trading. Our team has worked for years in sourcing of products and... Подробнее »
  • Ковры | Уплотнения, втулки и сальники для электрических кабелей | Электрические двигатели | Упаковочное оборудование | О...
  • Mumbai
  • Индия
supplyautonomy.com/ganpatielectricalspvt.in
Profile Established in the year 1998, Ganpati Electricals Pvt. Ltd. is amongst the leading manufacturers and traders of wide range of electrical equipment. We specialize in Servo Voltage... Подробнее »
  • Подрядчики в сфере производства и распределения электроэнергии | Другие услуги по дизайну | коробка с клеммами | дизель-...
  • Delhi
  • Индия
supplyautonomy.com/srisaienterprises.in
EXPORT PACKERS in Gujarat QUALITY PACKERS/vinyl packers/anti corrosive packaging DISTRIBUTOR OF Valvoline Cummins ltd. Tectyl products. Industrial lubricants distributors Polka dotted hand... Подробнее »
  • Подрядчики в сфере производства и распределения электроэнергии | Курьерские услуги | Краны с шаровым краном | Поворотные...
  • Warangal
  • Индия
supplyautonomy.com/crystalhomeappliancesindia.in
Ask it and you have it with CRYSTAL HOME APPLIANCES (INDIA) presenting a wide range of MLM products with guaranteed best price.  We are one of the biggest names engaged in the domain of offering ... Подробнее »
  • Услуги по разработке пользовательского (клиента) программного обеспечения | Оборудование для очистки | Минеральные воды ...
  • Jaipur
  • Индия
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... Подробнее »
  • Получение солнечной энергии | Консультанты по солнечной энергетике | Литиевые батареи | Солнечные продукты и оборудовани...
  • Gurgaon
  • Индия
supplyautonomy.com/zenithfilms.sg
At Zenith Window Films, we offer a spectrum of of 3m solar window films, 3m whiteboard films for home and window tinting in Singapore at cheap prices. We are dedicated to offer excellent service to... Подробнее »
  • Солнечные продукты и оборудование
  • singapore
  • Сингапур