Loading...
에 대한 검색 결과 : 태양 제품 및 장비
발견 6323 회사
supplyautonomy.com/hincoopower.ph
Hincoo Power offers comprehensive solutions that hugely augment the peak power shortage, given the development of the local economy, industry, and commerce. It has supported the rapid growth of the... 자세히보기 »
- 발전소, 태양 에너지 | 태양 광 발전소, 태양 전지 | 모듈 | 태양 광 패널 태양 광 트래커 | 태양 전지 패널을위한 보온 | 신 재생 에너지 업계 용 장비 | 태양 광 에너지 - 설치 | 태양 에너지 장비 | ...
- Shenzhen
- 중국
supplyautonomy.com/placasar1es.es
supplyautonomy.com/geospec.in
We are into business of providing turnkey solutions in Lighting Green Energy Solutions viz. Solar Wind energy solutions. We are operating in both Goverment as well as private sector have... 자세히보기 »
- 전기 부품 | 백열 램프 | 램프 및 야시경, 아세틸렌 | 램프, 오일 | 정신 램프 | 가스 램프 | 촛불 램프 | 마차 램프, 비 전기 | 를위한 램프가 아닌 전기, 부표 | 소방관을위한 비 전기 램프 및 야시경...
- Gurgaon
- 인도
supplyautonomy.com/apexenterprises.in
You will pleased to know that we professional in setup second hand Rolling mill,Induction or Arc furnace, Industrial Machinery and electrical items such as all type of motors(DC AC),Turbines,water... 자세히보기 »
- 건설 프로젝트 | 절연 재료 | 건설사 도구 | 문방구 | 지갑 | 상한과 overcapping 캡슐, 플라스틱 | 모터 | 배터리 팩 | 배기 시스템 | 원예 용품...
- Secunderabad
- 인도
supplyautonomy.com/indotechindustrialsolutionspvt.in
We are a diversified technology leader, providing integrated automation and software solutions to various industries like technology, power, service sector, mobile pstn line operators,... 자세히보기 »
- 분유 | 통신 - 장비 및 시스템 | 전자 공급 | 전기 부품 | 전기 및 전자 제품 | 디젤 발전기 | 항공 부품 | 전기 및 전자 장비 | 태양 제품 및 장비...
- Pune
- 인도
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... 자세히보기 »
- 보안 제품 대리점 | 전송 인쇄 | 사출 성형 서비스, 금속 | 절연 재료 | 사용자 정의 디자인 온천 | 커플 링 | 파이프 | 파이프 피팅 | 파이프 및 피팅 | 파이프 및 튜브, 주철...
- Amravati
- 인도
supplyautonomy.com/laxmiindustries.in
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... 자세히보기 »
- 보안 제품 대리점 | 전송 인쇄 | 사출 성형 서비스, 금속 | 절연 재료 | 사용자 정의 디자인 온천 | 커플 링 | 파이프 | 파이프 피팅 | 파이프 및 피팅 | 파이프 및 튜브, 주철...
- Mumbai
- 인도
supplyautonomy.com/yessolarsolutionscary.us
At Yes Solar Solutions, our unique advantage lies in our commitment to quality and the craftsmanship we bring to each project. We are the only NABCEP Accredited solar installer in North Carolina and... 자세히보기 »
- 태양 에너지 패널 설치 | 태양 전지 패널 지붕 덮개 작업 | 태양 전지 패널 | 태양 전지판 | 태양 제품 및 장비...
- Cary
- 미국
supplyautonomy.com/basantproductsindia.in
INTRODUCTION
M / S Basant Products (India) is a prestigious award winner for quality Marketing and three BIS licenses holder, manufacturer and Exporter of Diesel Generating Sets, Diesel Engines,... 자세히보기 »
- 기타 대리점 서비스 | 디젤 발전기 | 모터 | 식품 산업 플랜트 및 장비 NES | 잘 드릴링 기계 | 용접 장비 | 남성 스킨 케어 제품 | 태양 제품 및 장비...
- Agra
- 인도
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... 자세히보기 »
- 보안 제품 대리점 | 전송 인쇄 | 사출 성형 서비스, 금속 | 절연 재료 | 사용자 정의 디자인 온천 | 커플 링 | 파이프 | 파이프 피팅 | 파이프 및 피팅 | 파이프 및 튜브, 주철...
- Faridabad
- 인도
supplyautonomy.com/miplmanoharinternationalpvt.in
MIPL, one of the worlds most trusted brands, is a name with a long history that powers itself into new ventures. This trust extends to a series of products, services and solutions that cover diverse... 자세히보기 »
- 볼 밸브 | 버터 플라이 밸브 | 플라스틱 제품 | 기타 포장 자재 | 스테이플 와이어 | 석영 석재 | 견과류 | 스테인리스 플랜지 | 태양 제품 및 장비...
- Ahmedabad
- 인도
supplyautonomy.com/citadelarchitecturalsolutionspvt.in
Citadel Architectural Solutions Pvt. Ltd., is an innovative company headquartered in Mumbai. Citadel works with a number of innovative roofing and cladding products and solutions, as well as... 자세히보기 »
- 공기 청정기 | 지붕 | 장식 높은 압력 라미네이트 / HPL | 플라스틱 제품 | 플라스틱 필름 | 전자 간판 | 태양 제품 및 장비 | 실내 장식, 서비스,...
- Mumbai
- 인도
supplyautonomy.com/babaenterprises.in
Baba Enterprises is a name to reckon with the spectrum of latest garment accessories. The business avenues of our company comprises of manufacturing, supplying and exporting a wide range of apparel... 자세히보기 »
- 건설 프로젝트 | 건설사 도구 | 가구 | 민족 의류 | 직물 | 의류 리벳 | 전기 부품 | 잘 드릴링 기계 | 제약 기사 | 신발 옷걸이, 플라스틱, 저장...
- New Delhi
- 인도
supplyautonomy.com/ronakgroup.in
Ronak Rocks Pvt. Ltd. is a professionally managed organization engaged in the production of a variety of stone products in various sizes and finishes. Our range of natural stone and natural building... 자세히보기 »
- 건강 프로젝트 | 의류 디자인 서비스 | 기타 건물 돌 | 전기 부품 | 배터리 팩 | 비료 | 제약 기사 | 바디 스크럽 | 렌즈 공백, 안과, 유리 | 렌즈 공백, 광학 유리...
- Vadodara
- 인도
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade.
It has its offices at various places in India and has its global... 자세히보기 »
- 기계 견인 처리 서비스 | 섬유 폐기물 처리 서비스, 울 | 섬유 폐기물 처리 서비스, 헤어 | 섬유 폐기물 처리 서비스,면 | 섬유 폐기물 처리 서비스, 실크 | 아마 나 린넨 섬유 폐기물 처리 서비스 | 섬유 폐...
- Mumbai
- 인도
supplyautonomy.com/china.cn
supplyautonomy.com/jayagenciez.in
Jay Agenciez is an authorized agent in India for some of the worlds most famous Brands of Industrial Products. We are mainly into the Import and Export supplies of Industrial Consumables which are... 자세히보기 »
- 절연 재료 | 세척 장비 | 플라스틱 제품 | 접착제 및 테이프 | 용접 장비 | 스테이플 와이어 | 태양 제품 및 장비...
- Surat
- 인도
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... 자세히보기 »
- 보안 제품 대리점 | 전송 인쇄 | 사출 성형 서비스, 금속 | 절연 재료 | 사용자 정의 디자인 온천 | 커플 링 | 파이프 | 파이프 피팅 | 파이프 및 피팅 | 파이프 및 튜브, 주철...
- Ahmedabad
- 인도
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... 자세히보기 »
- 보안 제품 대리점 | 전송 인쇄 | 사출 성형 서비스, 금속 | 절연 재료 | 사용자 정의 디자인 온천 | 커플 링 | 파이프 | 파이프 피팅 | 파이프 및 피팅 | 파이프 및 튜브, 주철...
- Bardoli
- 인도
supplyautonomy.com/scientechtechnologiespvt.in
Scientech Technologies Pvt. Ltd. is an ISO 9001:2008 certified company that has a strong presence in educational, health care, environmental and industrial sectors. With more than 550 diverse... 자세히보기 »
- 전기 및 전자 제품 | 기타 전원 공급 장치 | 산업용 전원 공급 장치 | 잘 드릴링 기계 | 전기 및 전자 장비 | 의료 기기 | 태양 제품 및 장비 | 전기 테스트 및 측정 장비...
- Indore
- 인도
supplyautonomy.com/spaceagesecuritysystems.in
Spaceage Security Systems Ltd. is an exporter of India Solar Lamps products. With a well management system, Sisale strives to offer the best quality products and service as possible as we can, as... 자세히보기 »
- 전화 세트 | 통신 - 장비 및 시스템 | 전자 부품 | 전자 공급 | 전기 부품 | 차 경보 | 타임 레코더 | 전기 및 전자 장비 | 감시 장비 | 태양 제품 및 장비...
- Delhi
- 인도
supplyautonomy.com/uniquecombustion.in
Company Brief Empowered with technological expertise and service support of a highly skilled workforce, we, Unique Combustion, have emerged as one of the leading manufacturers, exporters, importers,... 자세히보기 »
- 비즈니스 여행 패키지 | 보일러 부품 | 버너, 산업용 | 모터 | 전기 및 전자 장비 | 태양 제품 및 장비 | 전기 테스트 및 측정 장비...
- New Delhi
- 인도
supplyautonomy.com/trademaxenterprise.in
TradeMax Enterprise has been founded by a team of professionals with rich experience in international business and Trading. Our team has worked for years in sourcing of products and... 자세히보기 »
- 카펫 | 케이블 그랜드 | 모터 | 포장 기계 | 옷 | 야자 껍질의 섬유 제품 | 고무 및 고무 제품 | 태양 제품 및 장비...
- Mumbai
- 인도
supplyautonomy.com/ganpatielectricalspvt.in
Profile
Established in the year 1998, Ganpati Electricals Pvt. Ltd. is amongst the leading manufacturers and traders of wide range of electrical equipment. We specialize in Servo Voltage... 자세히보기 »
- 전력 생산 및 유통 산업에 계약자 | 기타 디자인 서비스 | 터미널 블록 | 디젤 발전기 | 전기 및 전자 장비 | 에너지 - 생산 공장 및 설비 | 태양 제품 및 장비...
- Delhi
- 인도
supplyautonomy.com/crystalhomeappliancesindia.in
Ask it and you have it with CRYSTAL HOME APPLIANCES (INDIA) presenting a wide range of MLM products with guaranteed best price. We are one of the biggest names engaged in the domain of offering ... 자세히보기 »
- 맞춤 소프트웨어 개발 서비스 | 세척 장비 | 무 알코올 음료 | 직물 | 지갑 | 전기 및 전자 제품 | 곡물 혼합 기계 | 비료 | 제약 기사 | 가전 제품...
- Jaipur
- 인도
supplyautonomy.com/acmeinternational1.in
Established in 2003. Acme international is an exporters of machinery equipments for jewellery industries. We always strive to bring the latest and the best, keeping pace with
Technology, time and... 자세히보기 »
- 에어 커튼 | 플라스틱 제품 | 전기 및 전자 제품 | 보석을위한 용광로 | 보석을위한 압연기 | 보석 공백 장비를 각인 | 보석을위한 원심 주조 기계, 백색 금속, | 보석을위한 주조 장비, 정밀도, | 사슬 만드...
- Mumbai
- 인도
supplyautonomy.com/srisaienterprises.in
EXPORT PACKERS in Gujarat
QUALITY PACKERS/vinyl packers/anti corrosive packaging
DISTRIBUTOR OF Valvoline Cummins ltd. Tectyl products.
Industrial lubricants distributors
Polka dotted hand... 자세히보기 »
- 전력 생산 및 유통 산업에 계약자 | 택배 서비스 | 볼 밸브 | 버터 플라이 밸브 | 자루 및 가방 | 가방 | 플라스틱 제품 | 접착제 및 테이프 | 전자 부품 | 전자 데이터 시스템...
- Warangal
- 인도
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... 자세히보기 »
- 태양 에너지 생산 | 태양 에너지 컨설턴트 | 리튬 축전지 | 태양 제품 및 장비 | 태양 에너지 장비 제조업체...
- Gurgaon
- 인도
supplyautonomy.com/zenithfilms.sg
At Zenith Window Films, we offer a spectrum of of 3m solar window films, 3m whiteboard films for home and window tinting in Singapore at cheap prices. We are dedicated to offer excellent service to... 자세히보기 »
- 태양 제품 및 장비
- singapore
- 싱가포르