ძებნის შედეგები: მზის პროდუქტები და აღჭურვილობა

ნაპოვნია 6323 კომპანიები


supplyautonomy.com/hincoopower.ph
Hincoo Power offers comprehensive solutions that hugely augment the peak power shortage, given the development of the local economy, industry, and commerce. It has supported the rapid growth of the... დაწვრილებით »
  • სადგურების, მზის ენერგია | მზის ელექტროსადგური, photovoltaic საკანში | მოდულები | მზის trackers for photovoltaic პანელებ...
  • Shenzhen
  • ჩინეთი
supplyautonomy.com/placasar1es.es
  • გაყვანილობა მომსახურების ელექტრო ინდუსტრია | თერმული საიზოლაციო for მზის პანელები | განახლებადი ენერგია შენახვის ბატარეე...
  • Madrid
  • ესპანეთი
supplyautonomy.com/geospec.in
We are into business of providing turnkey solutions in Lighting Green Energy Solutions viz. Solar Wind energy solutions. We are operating in both Goverment as well as private sector have... დაწვრილებით »
  • ელექტრო კომპონენტები | ინკანდესენტური ნათურები | ნათურები და floodlights, acetylene | ნათურები, ნავთობის | Spirit ნათურე...
  • Gurgaon
  • ინდოეთი
supplyautonomy.com/apexenterprises.in
You will pleased to know that we professional in setup second hand Rolling mill,Induction or Arc furnace, Industrial Machinery and electrical items such as all type of motors(DC AC),Turbines,water... დაწვრილებით »
  • სამშენებლო პროექტების | საიზოლაციო მასალები | მშენებელთა ინსტრუმენტები | საკანცელარიო | ჩანთები | გადახურვა და overcappi...
  • Secunderabad
  • ინდოეთი
supplyautonomy.com/indotechindustrialsolutionspvt.in
We are a diversified technology leader, providing integrated automation and software solutions to various industries like technology, power, service sector, mobile pstn line operators,... დაწვრილებით »
  • რძის ფხვნილი | სატელეკომუნიკაციო - აღჭურვილობა და სისტემები | ელექტრონული წყაროები | ელექტრო კომპონენტები | ელექტრო და ე...
  • Pune
  • ინდოეთი
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... დაწვრილებით »
  • უსაფრთხოების პროდუქტის აგენტები | გადაცემის ბეჭდვა | ინჟექტორი ჩამოსხმა მომსახურება, რკინის | საიზოლაციო მასალები | საბა...
  • Amravati
  • ინდოეთი
supplyautonomy.com/laxmiindustries.in
Manufacturer and Exporters of Three Wheeler, Hand Operated Tricycles, Wheelchair, Walker, Crutches, Hearing Aids and Mopeds/Motor Cycles with Three Wheeler and Both Side Wheel Attachment System.
  • სიყალბის, ალუმინის | მშენებელთა ინსტრუმენტები | ბურთი სარქველებს | პეპელა სარქველები | ხორბალი | სამედიცინო ავეჯი | ტექს...
  • Indore
  • ინდოეთი
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... დაწვრილებით »
  • უსაფრთხოების პროდუქტის აგენტები | გადაცემის ბეჭდვა | ინჟექტორი ჩამოსხმა მომსახურება, რკინის | საიზოლაციო მასალები | საბა...
  • Mumbai
  • ინდოეთი
supplyautonomy.com/yessolarsolutionscary.us
At Yes Solar Solutions, our unique advantage lies in our commitment to quality and the craftsmanship we bring to each project. We are the only NABCEP Accredited solar installer in North Carolina and... დაწვრილებით »
  • მზის ენერგიის პანელი მონტაჟი | მზის პანელი სახურავის გადახურვა მუშაობა | მზის პანელები | მზის პანელი | მზის პროდუქტები დ...
  • Cary
  • ამერიკის შეერთებული შტატები
supplyautonomy.com/basantproductsindia.in
INTRODUCTION M / S Basant Products (India) is a prestigious award winner for quality Marketing and three BIS licenses holder, manufacturer and Exporter of Diesel Generating Sets, Diesel Engines,... დაწვრილებით »
  • სხვა სააგენტოების მომსახურეობები | დიზელის გენერატორების | ელექტროძრავის | კვების მრეწველობის მოწყობილობები და აღჭურვილო...
  • Agra
  • ინდოეთი
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... დაწვრილებით »
  • უსაფრთხოების პროდუქტის აგენტები | გადაცემის ბეჭდვა | ინჟექტორი ჩამოსხმა მომსახურება, რკინის | საიზოლაციო მასალები | საბა...
  • Faridabad
  • ინდოეთი
supplyautonomy.com/miplmanoharinternationalpvt.in
MIPL, one of the worlds most trusted brands, is a name with a long history that powers itself into new ventures. This trust extends to a series of products, services and solutions that cover diverse... დაწვრილებით »
  • ბურთი სარქველებს | პეპელა სარქველები | პლასტმასის პროდუქცია | სხვა შესაფუთ | Staples, მავთული | კვარცი ქვა | თხილი | ფოლ...
  • Ahmedabad
  • ინდოეთი
supplyautonomy.com/citadelarchitecturalsolutionspvt.in
Citadel Architectural Solutions Pvt. Ltd., is an innovative company headquartered in Mumbai. Citadel works with a number of innovative roofing and cladding products and solutions, as well as... დაწვრილებით »
  • ჰაერის გამწმენდები | სახურავი | დეკორატიული მაღალი წნევის LAMINATES / HPL | პლასტმასის პროდუქცია | პლასტიკური ფილმი | ელ...
  • Mumbai
  • ინდოეთი
supplyautonomy.com/babaenterprises.in
Baba Enterprises is a name to reckon with the spectrum of latest garment accessories. The business avenues of our company comprises of manufacturing, supplying and exporting a wide range of apparel... დაწვრილებით »
  • სამშენებლო პროექტების | მშენებელთა ინსტრუმენტები | ავეჯი | ეთნიკური ტანსაცმელი | ნაწარმი | სამკერვალო მოქლონები | ელექტრ...
  • New Delhi
  • ინდოეთი
supplyautonomy.com/ronakgroup.in
Ronak Rocks Pvt. Ltd. is a professionally managed organization engaged in the production of a variety of stone products in various sizes and finishes. Our range of natural stone and natural building... დაწვრილებით »
  • ჯანდაცვის პროექტები | ტანსაცმელი საპროექტო მომსახურება | სხვადასხვა შენობაში ქვის | ელექტრო კომპონენტები | ბატარეის პაკე...
  • Vadodara
  • ინდოეთი
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade. It has its offices at various places in India and has its global... დაწვრილებით »
  • მანქანა ორი დამუშავების მომსახურეობები | ტექსტილი ნარჩენების გადამამუშავებელი მომსახურება, ბამბა | ტექსტილი ნარჩენების გ...
  • Mumbai
  • ინდოეთი
supplyautonomy.com/china.cn
Self-aligning ball bearings, ball bearings, spherical roller bearings, roller bearings, angular contact ball bearings, ball bearings, cylindrical.
  • ინჟექტორი ჩამოსხმა მომსახურება, რკინის | მილები და მილები, ფოლადის | დასუფთავების აღჭურვილობა | მშენებელთა ინსტრუმენტები...
  • Hangzhou
  • ჩინეთი
supplyautonomy.com/jayagenciez.in
Jay Agenciez is an authorized agent in India for some of the worlds most famous Brands of Industrial Products. We are mainly into the Import and Export supplies of Industrial Consumables which are... დაწვრილებით »
  • საიზოლაციო მასალები | დასუფთავების აღჭურვილობა | პლასტმასის პროდუქცია | ადჰეზივები და ფირზე | შედუღების მოწყობილობები | ...
  • Surat
  • ინდოეთი
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... დაწვრილებით »
  • უსაფრთხოების პროდუქტის აგენტები | გადაცემის ბეჭდვა | ინჟექტორი ჩამოსხმა მომსახურება, რკინის | საიზოლაციო მასალები | საბა...
  • Ahmedabad
  • ინდოეთი
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... დაწვრილებით »
  • უსაფრთხოების პროდუქტის აგენტები | გადაცემის ბეჭდვა | ინჟექტორი ჩამოსხმა მომსახურება, რკინის | საიზოლაციო მასალები | საბა...
  • Bardoli
  • ინდოეთი
supplyautonomy.com/scientechtechnologiespvt.in
Scientech Technologies Pvt. Ltd. is an ISO 9001:2008 certified company that has a strong presence in educational, health care, environmental and industrial sectors. With more than 550 diverse... დაწვრილებით »
  • ელექტრო და ელექტრონული პროდუქტის | სხვა დენის წყაროები | სამრეწველო ელექტროენერგიის მიწოდება | კარგად საბურღი დანადგარებ...
  • Indore
  • ინდოეთი
supplyautonomy.com/spaceagesecuritysystems.in
Spaceage Security Systems Ltd. is an exporter of India Solar Lamps products. With a well management system, Sisale strives to offer the best quality products and service as possible as we can, as... დაწვრილებით »
  • სატელეფონო აპარატები | სატელეკომუნიკაციო - აღჭურვილობა და სისტემები | ელექტრონული კომპონენტები | ელექტრონული წყაროები | ...
  • Delhi
  • ინდოეთი
supplyautonomy.com/uniquecombustion.in
Company Brief Empowered with technological expertise and service support of a highly skilled workforce, we, Unique Combustion, have emerged as one of the leading manufacturers, exporters, importers,... დაწვრილებით »
  • ბიზნეს მოგზაურობა პაკეტები | Boiler ნაწილები | Burners, სამრეწველო | ელექტროძრავის | ელექტრო და ელექტრონული მოწყობილობებ...
  • New Delhi
  • ინდოეთი
supplyautonomy.com/trademaxenterprise.in
TradeMax Enterprise has been founded by a team of professionals with rich experience in international business and Trading. Our team has worked for years in sourcing of products and... დაწვრილებით »
  • ხალიჩების | საკაბელო ჯირკვლების | ელექტროძრავის | შეფუთვის მანქანები | ტანსაცმელი | Coir პროდუქცია | რეზინის და რეზინის ...
  • Mumbai
  • ინდოეთი
supplyautonomy.com/ganpatielectricalspvt.in
Profile Established in the year 1998, Ganpati Electricals Pvt. Ltd. is amongst the leading manufacturers and traders of wide range of electrical equipment. We specialize in Servo Voltage... დაწვრილებით »
  • კონტრაქტორებს ელექტროენერგიის წარმოების და დისტრიბუციისათვის | სხვა საპროექტო მომსახურება | Terminal ბლოკად | დიზელის გე...
  • Delhi
  • ინდოეთი
supplyautonomy.com/crystalhomeappliancesindia.in
Ask it and you have it with CRYSTAL HOME APPLIANCES (INDIA) presenting a wide range of MLM products with guaranteed best price.  We are one of the biggest names engaged in the domain of offering ... დაწვრილებით »
  • შეკვეთილი პროგრამული უზრუნველყოფის დამუშავების მომსახურება | დასუფთავების აღჭურვილობა | უალკოჰოლო სასმელების | ნაწარმი |...
  • Jaipur
  • ინდოეთი
supplyautonomy.com/acmeinternational1.in
Established in 2003. Acme international is an exporters of machinery equipments for jewellery industries. We always strive to bring the latest and the best, keeping pace with Technology, time and... დაწვრილებით »
  • საჰაერო ფარდები | პლასტმასის პროდუქცია | ელექტრო და ელექტრონული პროდუქტის | ღუმელი საიუველირო | მოძრავი ქარხნები საიუველ...
  • Mumbai
  • ინდოეთი
supplyautonomy.com/srisaienterprises.in
EXPORT PACKERS in Gujarat QUALITY PACKERS/vinyl packers/anti corrosive packaging DISTRIBUTOR OF Valvoline Cummins ltd. Tectyl products. Industrial lubricants distributors Polka dotted hand... დაწვრილებით »
  • კონტრაქტორებს ელექტროენერგიის წარმოების და დისტრიბუციისათვის | კურიერი მომსახურება | ბურთი სარქველებს | პეპელა სარქველებ...
  • Warangal
  • ინდოეთი
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... დაწვრილებით »
  • მზის ენერგიის წარმოების | მზის ენერგია კონსულტანტები | Lithium აკუმულატორები | მზის პროდუქტები და აღჭურვილობა | მზის ენე...
  • Gurgaon
  • ინდოეთი
supplyautonomy.com/zenithfilms.sg
At Zenith Window Films, we offer a spectrum of of 3m solar window films, 3m whiteboard films for home and window tinting in Singapore at cheap prices. We are dedicated to offer excellent service to... დაწვრილებით »
  • მზის პროდუქტები და აღჭურვილობა
  • singapore
  • სინგაპური