Resultados de la búsqueda para: Productos y equipos de energía solar
Empresas 6323 encontradossupplyautonomy.com/hincoopower.ph
Hincoo Power offers comprehensive solutions that hugely augment the peak power shortage, given the development of the local economy, industry, and commerce. It has supported the rapid growth of the... Leer más »
- Centrales de energía, energía solar | Centrales eléctricas de energía solar por célula fotovoltaica | Módulos | Segui...
- Shenzhen
- China
supplyautonomy.com/placasar1es.es
supplyautonomy.com/geospec.in
We are into business of providing turnkey solutions in Lighting Green Energy Solutions viz. Solar Wind energy solutions. We are operating in both Goverment as well as private sector have... Leer más »
- Componentes eléctricos | Lámparas incandescentes | Lámparas y proyectores de gas de acetileno | Lámparas de petroleo | L...
- Gurgaon
- India
supplyautonomy.com/apexenterprises.in
You will pleased to know that we professional in setup second hand Rolling mill,Induction or Arc furnace, Industrial Machinery and electrical items such as all type of motors(DC AC),Turbines,water... Leer más »
- Proyectos de Construcción | Los materiales de aislamiento | Herramientas para la construcción | Papelería | Billeteros |...
- Secunderabad
- India
supplyautonomy.com/indotechindustrialsolutionspvt.in
We are a diversified technology leader, providing integrated automation and software solutions to various industries like technology, power, service sector, mobile pstn line operators,... Leer más »
- Leche en polvo | Telecomunicaciones: material y sistemas | Material electrónico | Componentes eléctricos | Productos e...
- Pune
- India
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Leer más »
- Agentes Productos Seguridad | Impresión Transferencia | Moldeo por inyección de piezas metálicas | Los materiales de ai...
- Amravati
- India
supplyautonomy.com/laxmiindustries.in
Manufacturer and Exporters of Three Wheeler, Hand Operated Tricycles, Wheelchair, Walker, Crutches, Hearing Aids and Mopeds/Motor Cycles with Three Wheeler and Both Side Wheel Attachment System.
- Constructores de estructuras de aluminio | Herramientas para la construcción | Válvulas esféricas | Válvulas de mar...
- Indore
- India
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Leer más »
- Agentes Productos Seguridad | Impresión Transferencia | Moldeo por inyección de piezas metálicas | Los materiales de ai...
- Mumbai
- India
supplyautonomy.com/yessolarsolutionscary.us
At Yes Solar Solutions, our unique advantage lies in our commitment to quality and the craftsmanship we bring to each project. We are the only NABCEP Accredited solar installer in North Carolina and... Leer más »
- Instalación de paneles de energía solar | Revestimiento de cubiertas con placas solares | Paneles solares | Panel solar ...
- Cary
- Estados Unidos
supplyautonomy.com/basantproductsindia.in
INTRODUCTION
M / S Basant Products (India) is a prestigious award winner for quality Marketing and three BIS licenses holder, manufacturer and Exporter of Diesel Generating Sets, Diesel Engines,... Leer más »
- Otros Servicios de Agencia | Generador diesel | Motores eléctricos | Instalaciones y equipos para la industria de la ...
- Agra
- India
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Leer más »
- Agentes Productos Seguridad | Impresión Transferencia | Moldeo por inyección de piezas metálicas | Los materiales de ai...
- Faridabad
- India
supplyautonomy.com/miplmanoharinternationalpvt.in
MIPL, one of the worlds most trusted brands, is a name with a long history that powers itself into new ventures. This trust extends to a series of products, services and solutions that cover diverse... Leer más »
- Válvulas esféricas | Válvulas de mariposa | Productos de plástico | Otros materiales de embalaje | Grapas de alambre | P...
- Ahmedabad
- India
supplyautonomy.com/citadelarchitecturalsolutionspvt.in
Citadel Architectural Solutions Pvt. Ltd., is an innovative company headquartered in Mumbai. Citadel works with a number of innovative roofing and cladding products and solutions, as well as... Leer más »
- Purificador de aire | Tejados | Placas decorativas de alta presión / HPL | Productos de plástico | Película de plástico ...
- Mumbai
- India
supplyautonomy.com/babaenterprises.in
Baba Enterprises is a name to reckon with the spectrum of latest garment accessories. The business avenues of our company comprises of manufacturing, supplying and exporting a wide range of apparel... Leer más »
- Proyectos de Construcción | Herramientas para la construcción | Complementos de mobiliario | Ropa Étnica | Tejidos | Ro...
- New Delhi
- India
supplyautonomy.com/ronakgroup.in
Ronak Rocks Pvt. Ltd. is a professionally managed organization engaged in the production of a variety of stone products in various sizes and finishes. Our range of natural stone and natural building... Leer más »
- Proyecto de Salud | Servicios de Diseño de Moda | Diversas piedras de construcción | Componentes eléctricos | Paquetes d...
- Vadodara
- India
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade.
It has its offices at various places in India and has its global... Leer más »
- Elaboración de estopa para máquinas | Elaboración de desechos de lana | Elaboración de desechos de pelo | Elaboración de...
- Mumbai
- India
supplyautonomy.com/china.cn
supplyautonomy.com/jayagenciez.in
Jay Agenciez is an authorized agent in India for some of the worlds most famous Brands of Industrial Products. We are mainly into the Import and Export supplies of Industrial Consumables which are... Leer más »
- Los materiales de aislamiento | Equipo de Limpieza | Productos de plástico | Adhesivos y cintas | Equipo de soldadura | ...
- Surat
- India
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Leer más »
- Agentes Productos Seguridad | Impresión Transferencia | Moldeo por inyección de piezas metálicas | Los materiales de ai...
- Ahmedabad
- India
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Leer más »
- Agentes Productos Seguridad | Impresión Transferencia | Moldeo por inyección de piezas metálicas | Los materiales de ai...
- Bardoli
- India
supplyautonomy.com/scientechtechnologiespvt.in
Scientech Technologies Pvt. Ltd. is an ISO 9001:2008 certified company that has a strong presence in educational, health care, environmental and industrial sectors. With more than 550 diverse... Leer más »
- Productos eléctricos y electrónicos | Otras Fuentes de alimentación | Fuente de alimentación Industrial | Máquinas para ...
- Indore
- India
supplyautonomy.com/spaceagesecuritysystems.in
Spaceage Security Systems Ltd. is an exporter of India Solar Lamps products. With a well management system, Sisale strives to offer the best quality products and service as possible as we can, as... Leer más »
- Aparatos telefónicos | Telecomunicaciones: material y sistemas | Componentes electrónicos | Material electrónico | Co...
- Delhi
- India
supplyautonomy.com/uniquecombustion.in
Company Brief Empowered with technological expertise and service support of a highly skilled workforce, we, Unique Combustion, have emerged as one of the leading manufacturers, exporters, importers,... Leer más »
- Paquetes Viajes de Negocios | Piezas de la caldera | Quemadores industriales | Motores eléctricos | Equipos eléctricos y...
- New Delhi
- India
supplyautonomy.com/trademaxenterprise.in
TradeMax Enterprise has been founded by a team of professionals with rich experience in international business and Trading. Our team has worked for years in sourcing of products and... Leer más »
- Alfombras | Casquillos para paso de cables eléctricos | Motores eléctricos | Maquinaria de embalaje | Prendas de vestir ...
- Mumbai
- India
supplyautonomy.com/ganpatielectricalspvt.in
Profile
Established in the year 1998, Ganpati Electricals Pvt. Ltd. is amongst the leading manufacturers and traders of wide range of electrical equipment. We specialize in Servo Voltage... Leer más »
- Contratistas de la industria productora y distribuidora de electricidad | Otros Servicios Diseño | Terminales | ...
- Delhi
- India
supplyautonomy.com/crystalhomeappliancesindia.in
Ask it and you have it with CRYSTAL HOME APPLIANCES (INDIA) presenting a wide range of MLM products with guaranteed best price. We are one of the biggest names engaged in the domain of offering ... Leer más »
- Servicios de desarrollo de software personalizado | Equipo de Limpieza | Bebidas sin alcohol | Tejidos | Billeteros |...
- Jaipur
- India
supplyautonomy.com/acmeinternational1.in
Established in 2003. Acme international is an exporters of machinery equipments for jewellery industries. We always strive to bring the latest and the best, keeping pace with
Technology, time and... Leer más »
- Cortinas de aire | Productos de plástico | Productos eléctricos y electrónicos | Hornos para joyería | Laminadores para ...
- Mumbai
- India
supplyautonomy.com/srisaienterprises.in
EXPORT PACKERS in Gujarat
QUALITY PACKERS/vinyl packers/anti corrosive packaging
DISTRIBUTOR OF Valvoline Cummins ltd. Tectyl products.
Industrial lubricants distributors
Polka dotted hand... Leer más »
- Contratistas de la industria productora y distribuidora de electricidad | Servicios de correo rápido | Válvulas e...
- Warangal
- India
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... Leer más »
- Producción de energía solar | Consultores en energía solar | Acumuladores de litio | Productos y equipos de energía sol...
- Gurgaon
- India
supplyautonomy.com/zenithfilms.sg
At Zenith Window Films, we offer a spectrum of of 3m solar window films, 3m whiteboard films for home and window tinting in Singapore at cheap prices. We are dedicated to offer excellent service to... Leer más »
- Productos y equipos de energía solar
- singapore
- Singapur