Resultados de la búsqueda para: Hilos y fibras
Empresas 13544 encontradosCategorías relacionadas
supplyautonomy.com/pacifictextiles.pk
Pacific Textiles
COMPANY:
Pacific Textiles is a professionally managed company with a vast experience in the textile sector. We mainly provide following services to our valuable customers;
(a)... Leer más »
- Hilo Mezcla Poliéster
- Lahore
- Pakistán
supplyautonomy.com/anhphat.vn
Anh Phat Co,.LTD was established in 2007, activities in the field of import-export, trading of yarns and textile products.
Since establishment, collective our company with the mottoes... Leer más »
- Hilo Algodón 100%
- Nam Dinh
- Vietnam
supplyautonomy.com/vietgoldenstarcompany.vn
We are Joint Stock Company, our factory has established on 2006 / June which was specialized in Yarn production scope. Our yarn is available for selling on 2007. In the first stage, our product was... Leer más »
- Hilo Algodón 100%
- Ho Chi Minh
- Vietnam
supplyautonomy.com/vietcottonyarnjsc.vn
Dear All Valuable Customer,
My name is Pham Le Cao Tri, I represent a company called Viet Cotton. One of Viet Cotton's roles is to function as an sole Agent for ThienNam Spinning, we are also... Leer más »
- Hilo Algodón 100%
- Ho Chi Minh
- Vietnam
supplyautonomy.com/dongphatjscco.vn
The DONGPHAT joint stock Company was established in May 2007 by 3 main shareholders who are having long- term experiences in trade, investment and production in textile field especially in yarn... Leer más »
- Hilo Algodón 100%
- Hanoi City
- Vietnam
supplyautonomy.com/gimatexindustriespvtlimited.in
Gimatex is a leading quality yarn producing company having a diverse product basket. It can manufacture "Ring Spun", "Open End", "Air-Jet" and "Compact" yarns... Leer más »
- Hilo Mezcla Poliéster
- Hinganghat
- India
supplyautonomy.com/biraltextilemills.in
BIRLA TEXTILE GROUP belongs to K.K. BIRLA GROUP OF COMPNIES, CHABAL FERTILISERS AND CHEMICAL LIMITED.
Our spinning unit is the 3rd (latest) most modern spinning unit- BIRLA TEXTILE... Leer más »
- Hilo Algodón 100%
- Mumbai
- India
supplyautonomy.com/birlatextilemills.in
BIRLA TEXTILE MILLS, INDIA
We belong to K. K. Birla Group which is among the Top 20 Business Houses in India. Besides Textiles, the group has strong presence in other industries like fertilizers,... Leer más »
- Hilo Algodón 100%
- Mumbai
- India
supplyautonomy.com/alltexeximpvt1.in
Dear Concern,
We All Tex Exim Pvt. Ltd. introduce our self as Leading Exporter of high quality of Polyester Yarns Chips. We have exclusive tie-ups with Leading Manufacturer from India, who... Leer más »
- Hilo Algodón 100%
- Surat
- India
supplyautonomy.com/askhallimpisacasllisac.pe
We are pleased to introduce ASLLI SAC as a company dedicated to developing sustainable activities related to the textile activity.
Our experience in the manufacturing of hand spun cotton yarns, is... Leer más »
- Hilo Algodón 100%
- Miraflores
- Perú
supplyautonomy.com/hiretexsrl.pe
We are a company dedicated to making Tanguis Peruvian cotton yarn
for Industrial and Craft Twisted spindle 8 / 2, 8 / 3, 8 / 4, 12 / 2.16 / 2.20 / 2.24 / 2.30 / 2
Special threads like 20/2X5,... Leer más »
- Hilo Algodón 100%
- Lima
- Perú
supplyautonomy.com/kaganlaryapiinstarimvetekstilticsti.tr
We are manufacturing regenerated blended pre-dyed yarns (Open End),
- Our usual blends are Cotton/Polyester and Cotton /Acrylic (50/50, 70/30, 80/20, 90/10) Open end blended yarns ranged from Ne... Leer más »
- Hilo Algodón 100%
- Denizli
- Turquía
supplyautonomy.com/culcuoglufabrics.tr
supplyautonomy.com/ethigtradingco.tr
Ethig Trading Co. (ETA-Ment) is a trading company located in following cities of Turkey :
Istanbul
Bursa
Kahramanmaras.
Our company is focused on exporting 1'st grade supreme goods which... Leer más »
- Hilo Algodón 100%
- Bursa
- Turquía
supplyautonomy.com/paradisetradingco.eg
Dear Sirs,
We are International Trading company since 1999.
We do have our office located at Cairo / Egypt and Barcelona / Spain.
We do export Soft Drinks and Food Stuff as well.
For all... Leer más »
- Bebida energética | Hilo Algodón 100% | Hilo Fancy | Fertilizantes Fosfato | Silicato
- Cairo
- Egipto
supplyautonomy.com/birkobirlesikkoyunlulularmensucatticaretvesanayias.tr
Birko Birlesik Koyunlulular Mensucat Ticaret ve Sanayi A.S. was founded in 1972 with the initiatives of Koyunlu village citizens in Nigde. Factory construction started in 1973 and production started... Leer más »
- Alfombras de fabricación industrial | Algodón: hilos e hilados | Hilo Algodón 100%
- Niğde
- Turquía
supplyautonomy.com/almirajimpex.pk
INTRODUCTION
AL-MIRAJ IMPEX (Pvt) Ltd. established in 1998 is in textile export business since last 10 years. Yet despite our impressive growth and remarkable success AL-MIRAJ IMPEX (Pvt) Ltd. ... Leer más »
- Hilo Algodón 100%
- Lahore
- Pakistán
supplyautonomy.com/texcelglobal.pk
Having been established in 2008, Texcel Global is a contemporary textile sourcing house for domestic and international customers, specializing in all forms and types of Cotton and Yarn. Texcel... Leer más »
- Hilo Algodón 100%
- Lahore
- Pakistán
supplyautonomy.com/dongyangqianxiangseasonglovesfactory.cn
Dongyang Qianxiang Season Gloves Factory is located in Dongyang, near International Commercial City - Yiwu. The transportation is very convenient.It is near shanghai and ningbo port.
Our company... Leer más »
- Hilo Bordado
- Yiwu
- China
supplyautonomy.com/rahulprintspvt.in
Dear Sir
We are oldest textile co in Surat (The textile diamond city) in India named Shobha International having our own manufacturing unit. We are having machines like power loom water jet rapier... Leer más »
- Hilo Mezcla | Ropa para señoras
- Surat
- India
supplyautonomy.com/starworldimpex.in
Star World Impex ,setting new paradigms of excellence, welcomes you to its domain. we have a perception to provide impeccable solution to the diversified needs of the people worldwide, Star world... Leer más »
- Bananas/Plátanos Frescos | Aceite de coco | Hilado | Bolsos | Prendas de vestir
- Chennai
- India
supplyautonomy.com/srmimpexpvt.in
We are traders of Cotton based at Indore (M. P. ) India. Our Company "SRM Impex Pvt. Ltd. " has been Certified by Control Union (SKAL) "S. R. Marketing" has been Certified by... Leer más »
- Algodón en rama | Hilado | Prendas de vestir
- Indore
- India
supplyautonomy.com/sutlejtextilesandindustrieslimited.in
- Pantalones | Tejido de Poliéster | Tejido de Rayón | Tejido de Viscosa | Hilado | Bolsos | Tela de lino | Seda, tela d...
- Mumbai
- India
supplyautonomy.com/kanishkenterprises.in
We are engaged in wholesaling, exporting supplying a wide array of textile products. We specialize in excellent range of textile products like Yarn, Fabric and Made Ups. Fabricated in accordance... Leer más »
- Pantalones | Tejidos | Hilado | Edredones rellenos de plumas
- Chandigarh
- India
supplyautonomy.com/ramswarooprattanlal.in
- Prendas de punto | Tejido de Nilón | Tejido de Poliéster | Hilado | Hilo de Poliéster | Calzado | Bordado y tejido | Ma...
- Delhi
- India
supplyautonomy.com/kaviramexim.in
- Cocos Frescos | Productos textiles | Pantalones | Prendas de punto | Tejidos | Hilado | Ropa para señoras | Prendas de ...
- Coimbatore
- India
supplyautonomy.com/interglobal.in
We are a general trading company, operating from our offices in India, Dubai and China
We are mainly dealing in Building materialslike timber, plywood, veneer, doors, moulded door skins, veneered... Leer más »
- Granos de cacao | Hilado | Productos y materias primas Agro
- Ahmedabad
- India
supplyautonomy.com/santoshiexports.in
Exporter of Raw Cotton, Yarns, Agriculture Products, Handicrafts (Silver & Metal) Articles.
- Algodón en rama (tratantes) | Algodón en rama (mediadores) | Hilado | Mano alfombras anudadas | Mano alfombras de pelo |...
- Khamgaon
- India
supplyautonomy.com/guriplik.tr
Gur Iplik Industry and Trade Incorporated Business, starded producing first class acrylic yarn in 2008 with a capacity of 20 tons/day, a closed area of 40.000 sqm, and 250 employees. The company is... Leer más »
- Hilos e hilados artificiales y sintéticos | Hilo Acrílico 100%
- Gaziantep
- Turquía
supplyautonomy.com/grodnokhimvoloknojsc.by
JSC Grodno Khimvolokno is the large manufacturer of a polyamide thread, including twisted; polyester threads HMLS, cord hard and impregnated fabric; technical fabric ЕР; polyamide textured threads B... Leer más »
- Hilos e hilados artificiales y sintéticos | Hilos e hilados textiles
- Sopot
- Bielorrusia