Otsingu tulemused: Lõng ja niit

Leitud 13544 ettevõtted

Kategooriad


supplyautonomy.com/pacifictextiles.pk
Pacific Textiles COMPANY: Pacific Textiles is a professionally managed company with a vast experience in the textile sector. We mainly provide following services to our valuable customers; (a)... Loe edasi »
  • Polüester segatud lõngast
  • Lahore
  • Pakistan
supplyautonomy.com/anhphat.vn
Anh Phat Co,.LTD was established in 2007, activities in the field of import-export, trading of yarns and textile products. Since establishment, collective our company with the mottoes... Loe edasi »
  • 100% puuvillane lõng
  • Nam Dinh
  • Vietnam
supplyautonomy.com/vietgoldenstarcompany.vn
We are Joint Stock Company, our factory has established on 2006 / June which was specialized in Yarn production scope. Our yarn is available for selling on 2007. In the first stage, our product was... Loe edasi »
  • 100% puuvillane lõng
  • Ho Chi Minh
  • Vietnam
supplyautonomy.com/vietcottonyarnjsc.vn
Dear All Valuable Customer, My name is Pham Le Cao Tri, I represent a company called Viet Cotton. One of Viet Cotton's roles is to function as an sole Agent for ThienNam Spinning, we are also... Loe edasi »
  • 100% puuvillane lõng
  • Ho Chi Minh
  • Vietnam
supplyautonomy.com/dongphatjscco.vn
The DONGPHAT joint stock Company was established in May 2007 by 3 main shareholders who are having long- term experiences in trade, investment and production in textile field especially in yarn... Loe edasi »
  • 100% puuvillane lõng
  • Hanoi City
  • Vietnam
supplyautonomy.com/gimatexindustriespvtlimited.in
Gimatex is a leading quality yarn producing company having a diverse product basket. It can manufacture "Ring Spun", "Open End", "Air-Jet" and "Compact" yarns... Loe edasi »
  • Polüester segatud lõngast
  • Hinganghat
  • India
supplyautonomy.com/biraltextilemills.in
BIRLA TEXTILE GROUP belongs to K.K. BIRLA GROUP OF COMPNIES, CHABAL FERTILISERS AND CHEMICAL LIMITED. Our spinning unit is the 3rd (latest) most modern spinning unit- BIRLA TEXTILE... Loe edasi »
  • 100% puuvillane lõng
  • Mumbai
  • India
supplyautonomy.com/birlatextilemills.in
BIRLA TEXTILE MILLS, INDIA We belong to K. K. Birla Group which is among the Top 20 Business Houses in India. Besides Textiles, the group has strong presence in other industries like fertilizers,... Loe edasi »
  • 100% puuvillane lõng
  • Mumbai
  • India
supplyautonomy.com/alltexeximpvt1.in
Dear Concern, We All Tex Exim Pvt. Ltd. introduce our self as Leading Exporter of high quality of Polyester Yarns Chips. We have exclusive tie-ups with Leading Manufacturer from India, who... Loe edasi »
  • 100% puuvillane lõng
  • Surat
  • India
supplyautonomy.com/askhallimpisacasllisac.pe
We are pleased to introduce ASLLI SAC as a company dedicated to developing sustainable activities related to the textile activity. Our experience in the manufacturing of hand spun cotton yarns, is... Loe edasi »
  • 100% puuvillane lõng
  • Miraflores
  • Peruu
supplyautonomy.com/hiretexsrl.pe
We are a company dedicated to making Tanguis Peruvian cotton yarn for Industrial and Craft Twisted spindle 8 / 2, 8 / 3, 8 / 4, 12 / 2.16 / 2.20 / 2.24 / 2.30 / 2 Special threads like 20/2X5,... Loe edasi »
  • 100% puuvillane lõng
  • Lima
  • Peruu
supplyautonomy.com/kaganlaryapiinstarimvetekstilticsti.tr
We are manufacturing regenerated blended pre-dyed yarns (Open End), - Our usual blends are Cotton/Polyester and Cotton /Acrylic (50/50, 70/30, 80/20, 90/10) Open end blended yarns ranged from Ne... Loe edasi »
  • 100% puuvillane lõng
  • Denizli
  • Türgi
supplyautonomy.com/culcuoglufabrics.tr
We are producer of knited fabric producer in Istanbul/Turkey. We can produce all kind of knitted fabric like single jarsey, rib, interlock, lacost etc.
  • 100% puuvillane lõng
  • Istanbul
  • Türgi
supplyautonomy.com/ethigtradingco.tr
Ethig Trading Co. (ETA-Ment) is a trading company located in following cities of Turkey : Istanbul Bursa Kahramanmaras. Our company is focused on exporting 1'st grade supreme goods which... Loe edasi »
  • 100% puuvillane lõng
  • Bursa
  • Türgi
supplyautonomy.com/paradisetradingco.eg
Dear Sirs, We are International Trading company since 1999. We do have our office located at Cairo / Egypt and Barcelona / Spain. We do export Soft Drinks and Food Stuff as well. For all... Loe edasi »
  • Energiajoogid | 100% puuvillane lõng | Fancy lõnga | Fosforväetisena | Silikaat
  • Cairo
  • Egiptus
supplyautonomy.com/birkobirlesikkoyunlulularmensucatticaretvesanayias.tr
Birko Birlesik Koyunlulular Mensucat Ticaret ve Sanayi A.S. was founded in 1972 with the initiatives of Koyunlu village citizens in Nigde. Factory construction started in 1973 and production started... Loe edasi »
  • Masinkootud vaibad | Puuvillalõngad ja -niidid | 100% puuvillane lõng
  • Niğde
  • Türgi
supplyautonomy.com/almirajimpex.pk
INTRODUCTION AL-MIRAJ IMPEX (Pvt) Ltd. established in 1998 is in textile export business since last 10 years. Yet despite our impressive growth and remarkable success AL-MIRAJ IMPEX (Pvt) Ltd. ... Loe edasi »
  • 100% puuvillane lõng
  • Lahore
  • Pakistan
supplyautonomy.com/texcelglobal.pk
Having been established in 2008, Texcel Global is a contemporary textile sourcing house for domestic and international customers, specializing in all forms and types of Cotton and Yarn. Texcel... Loe edasi »
  • 100% puuvillane lõng
  • Lahore
  • Pakistan
supplyautonomy.com/dongyangqianxiangseasonglovesfactory.cn
Dongyang Qianxiang Season Gloves Factory is located in Dongyang, near International Commercial City - Yiwu. The transportation is very convenient.It is near shanghai and ningbo port. Our company... Loe edasi »
  • Tikandid lõng
  • Yiwu
  • Hiina
supplyautonomy.com/rahulprintspvt.in
Dear Sir We are oldest textile co in Surat (The textile diamond city) in India named Shobha International having our own manufacturing unit. We are having machines like power loom water jet rapier... Loe edasi »
  • Melange lõng | Naisterõivad
  • Surat
  • India
supplyautonomy.com/starworldimpex.in
Star World Impex ,setting new paradigms of excellence, welcomes you to its domain. we have a perception to provide impeccable solution to the diversified needs of the people worldwide, Star world... Loe edasi »
  • Värsked banaanid | Kookospähkliõli | Lõng | Kotid | Rõivad
  • Chennai
  • India
supplyautonomy.com/srmimpexpvt.in
We are traders of Cotton based at Indore (M. P. ) India. Our Company "SRM Impex Pvt. Ltd. " has been Certified by Control Union (SKAL) "S. R. Marketing" has been Certified by... Loe edasi »
  • Toorpuuvill | Lõng | Rõivad
  • Indore
  • India
supplyautonomy.com/sutlejtextilesandindustrieslimited.in
  • Püksid ja püksid | Polüester kangast | Rayon kangast | Viskoos riie | Lõng | Kotid | Linane riie | Siid, siid riie
  • Mumbai
  • India
supplyautonomy.com/kanishkenterprises.in
We are engaged in wholesaling, exporting supplying a wide array of textile products. We specialize in excellent range of textile products like Yarn, Fabric and Made Ups. Fabricated in accordance... Loe edasi »
  • Püksid ja püksid | Kangad | Lõng | Vateeritud tekk, sulgedega/udusulgedega täidetud
  • Chandigarh
  • India
supplyautonomy.com/ramswarooprattanlal.in
  • Trikookangast | Nailon kangast | Polüester kangast | Lõng | Polüesterfilamentlõnga | Jalatsid | Tikandid ja käsitöö teks...
  • Delhi
  • India
supplyautonomy.com/kaviramexim.in
  • Värsked kookospähklid | Tekstiili seonduvad tooted | Püksid ja püksid | Trikookangast | Kangad | Lõng | Naisterõivad | R...
  • Coimbatore
  • India
supplyautonomy.com/interglobal.in
We are a general trading company, operating from our offices in India, Dubai and China We are mainly dealing in Building materialslike timber, plywood, veneer, doors, moulded door skins, veneered... Loe edasi »
  • Kakaooad | Lõng | Agro toodete ja kaupade
  • Ahmedabad
  • India
supplyautonomy.com/santoshiexports.in
Exporter of Raw Cotton, Yarns, Agriculture Products, Handicrafts (Silver & Metal) Articles.
  • Toorpuuvill, kauplejad | Maaklerid, toorpuuvill | Lõng | Sõlmtehnikas vaibad | Käsitsi karvastatud vaibad | Agro to...
  • Khamgaon
  • India
supplyautonomy.com/guriplik.tr
Gur Iplik Industry and Trade Incorporated Business, starded producing first class acrylic yarn in 2008 with a capacity of 20 tons/day, a closed area of 40.000 sqm, and 250 employees. The company is... Loe edasi »
  • Kunst- ja sünteetilised lõngad ja niidid | 100% akrüül lõng
  • Gaziantep
  • Türgi
supplyautonomy.com/grodnokhimvoloknojsc.by
JSC Grodno Khimvolokno is the large manufacturer of a polyamide thread, including twisted; polyester threads HMLS, cord hard and impregnated fabric; technical fabric ЕР; polyamide textured threads B... Loe edasi »
  • Kunst- ja sünteetilised lõngad ja niidid | Lõngad ja niidid
  • Sopot
  • Valgevene