ძებნის შედეგები: ძაფებისაგან და twists

ნაპოვნია 13544 კომპანიები

ამავე კატეგორიაში


supplyautonomy.com/pacifictextiles.pk
Pacific Textiles COMPANY: Pacific Textiles is a professionally managed company with a vast experience in the textile sector. We mainly provide following services to our valuable customers; (a)... დაწვრილებით »
  • პოლიეთერი შერეული ნართი
  • Lahore
  • პაკისტანი
supplyautonomy.com/anhphat.vn
Anh Phat Co,.LTD was established in 2007, activities in the field of import-export, trading of yarns and textile products. Since establishment, collective our company with the mottoes... დაწვრილებით »
  • 100% ბამბა ძაფებისაგან
  • Nam Dinh
  • ვიეტნამი
supplyautonomy.com/vietgoldenstarcompany.vn
We are Joint Stock Company, our factory has established on 2006 / June which was specialized in Yarn production scope. Our yarn is available for selling on 2007. In the first stage, our product was... დაწვრილებით »
  • 100% ბამბა ძაფებისაგან
  • Ho Chi Minh
  • ვიეტნამი
supplyautonomy.com/vietcottonyarnjsc.vn
Dear All Valuable Customer, My name is Pham Le Cao Tri, I represent a company called Viet Cotton. One of Viet Cotton's roles is to function as an sole Agent for ThienNam Spinning, we are also... დაწვრილებით »
  • 100% ბამბა ძაფებისაგან
  • Ho Chi Minh
  • ვიეტნამი
supplyautonomy.com/dongphatjscco.vn
The DONGPHAT joint stock Company was established in May 2007 by 3 main shareholders who are having long- term experiences in trade, investment and production in textile field especially in yarn... დაწვრილებით »
  • 100% ბამბა ძაფებისაგან
  • Hanoi City
  • ვიეტნამი
supplyautonomy.com/gimatexindustriespvtlimited.in
Gimatex is a leading quality yarn producing company having a diverse product basket. It can manufacture "Ring Spun", "Open End", "Air-Jet" and "Compact" yarns... დაწვრილებით »
  • პოლიეთერი შერეული ნართი
  • Hinganghat
  • ინდოეთი
supplyautonomy.com/biraltextilemills.in
BIRLA TEXTILE GROUP belongs to K.K. BIRLA GROUP OF COMPNIES, CHABAL FERTILISERS AND CHEMICAL LIMITED. Our spinning unit is the 3rd (latest) most modern spinning unit- BIRLA TEXTILE... დაწვრილებით »
  • 100% ბამბა ძაფებისაგან
  • Mumbai
  • ინდოეთი
supplyautonomy.com/birlatextilemills.in
BIRLA TEXTILE MILLS, INDIA We belong to K. K. Birla Group which is among the Top 20 Business Houses in India. Besides Textiles, the group has strong presence in other industries like fertilizers,... დაწვრილებით »
  • 100% ბამბა ძაფებისაგან
  • Mumbai
  • ინდოეთი
supplyautonomy.com/alltexeximpvt1.in
Dear Concern, We All Tex Exim Pvt. Ltd. introduce our self as Leading Exporter of high quality of Polyester Yarns Chips. We have exclusive tie-ups with Leading Manufacturer from India, who... დაწვრილებით »
  • 100% ბამბა ძაფებისაგან
  • Surat
  • ინდოეთი
supplyautonomy.com/askhallimpisacasllisac.pe
We are pleased to introduce ASLLI SAC as a company dedicated to developing sustainable activities related to the textile activity. Our experience in the manufacturing of hand spun cotton yarns, is... დაწვრილებით »
  • 100% ბამბა ძაფებისაგან
  • Miraflores
  • პერუ
supplyautonomy.com/hiretexsrl.pe
We are a company dedicated to making Tanguis Peruvian cotton yarn for Industrial and Craft Twisted spindle 8 / 2, 8 / 3, 8 / 4, 12 / 2.16 / 2.20 / 2.24 / 2.30 / 2 Special threads like 20/2X5,... დაწვრილებით »
  • 100% ბამბა ძაფებისაგან
  • Lima
  • პერუ
supplyautonomy.com/kaganlaryapiinstarimvetekstilticsti.tr
We are manufacturing regenerated blended pre-dyed yarns (Open End), - Our usual blends are Cotton/Polyester and Cotton /Acrylic (50/50, 70/30, 80/20, 90/10) Open end blended yarns ranged from Ne... დაწვრილებით »
  • 100% ბამბა ძაფებისაგან
  • Denizli
  • თურქეთი
supplyautonomy.com/culcuoglufabrics.tr
We are producer of knited fabric producer in Istanbul/Turkey. We can produce all kind of knitted fabric like single jarsey, rib, interlock, lacost etc.
  • 100% ბამბა ძაფებისაგან
  • Istanbul
  • თურქეთი
supplyautonomy.com/ethigtradingco.tr
Ethig Trading Co. (ETA-Ment) is a trading company located in following cities of Turkey : Istanbul Bursa Kahramanmaras. Our company is focused on exporting 1'st grade supreme goods which... დაწვრილებით »
  • 100% ბამბა ძაფებისაგან
  • Bursa
  • თურქეთი
supplyautonomy.com/paradisetradingco.eg
Dear Sirs, We are International Trading company since 1999. We do have our office located at Cairo / Egypt and Barcelona / Spain. We do export Soft Drinks and Food Stuff as well. For all... დაწვრილებით »
  • ენერგეტიკული სასმელების | 100% ბამბა ძაფებისაგან | Fancy ნართი | ფოსფატი სასუქი | სილიკატური...
  • Cairo
  • ეგვიპტე
supplyautonomy.com/birkobirlesikkoyunlulularmensucatticaretvesanayias.tr
Birko Birlesik Koyunlulular Mensucat Ticaret ve Sanayi A.S. was founded in 1972 with the initiatives of Koyunlu village citizens in Nigde. Factory construction started in 1973 and production started... დაწვრილებით »
  • ხალიჩების, მანქანა დამზადებული | Cotton - თემა და ძაფებისაგან | 100% ბამბა ძაფებისაგან...
  • Niğde
  • თურქეთი
supplyautonomy.com/almirajimpex.pk
INTRODUCTION AL-MIRAJ IMPEX (Pvt) Ltd. established in 1998 is in textile export business since last 10 years. Yet despite our impressive growth and remarkable success AL-MIRAJ IMPEX (Pvt) Ltd. ... დაწვრილებით »
  • 100% ბამბა ძაფებისაგან
  • Lahore
  • პაკისტანი
supplyautonomy.com/texcelglobal.pk
Having been established in 2008, Texcel Global is a contemporary textile sourcing house for domestic and international customers, specializing in all forms and types of Cotton and Yarn. Texcel... დაწვრილებით »
  • 100% ბამბა ძაფებისაგან
  • Lahore
  • პაკისტანი
supplyautonomy.com/dongyangqianxiangseasonglovesfactory.cn
Dongyang Qianxiang Season Gloves Factory is located in Dongyang, near International Commercial City - Yiwu. The transportation is very convenient.It is near shanghai and ningbo port. Our company... დაწვრილებით »
  • Embroidery ძაფები
  • Yiwu
  • ჩინეთი
supplyautonomy.com/rahulprintspvt.in
Dear Sir We are oldest textile co in Surat (The textile diamond city) in India named Shobha International having our own manufacturing unit. We are having machines like power loom water jet rapier... დაწვრილებით »
  • Melange ძაფები | ტანსაცმელი, ქალთა
  • Surat
  • ინდოეთი
supplyautonomy.com/starworldimpex.in
Star World Impex ,setting new paradigms of excellence, welcomes you to its domain. we have a perception to provide impeccable solution to the diversified needs of the people worldwide, Star world... დაწვრილებით »
  • ახალი ბანანის | ქოქოსის ზეთი | ნართი | ჩანთები | ტანსაცმელი...
  • Chennai
  • ინდოეთი
supplyautonomy.com/srmimpexpvt.in
We are traders of Cotton based at Indore (M. P. ) India. Our Company "SRM Impex Pvt. Ltd. " has been Certified by Control Union (SKAL) "S. R. Marketing" has been Certified by... დაწვრილებით »
  • ნედლეული ბამბა | ნართი | ტანსაცმელი
  • Indore
  • ინდოეთი
supplyautonomy.com/sutlejtextilesandindustrieslimited.in
  • შარვალი და შარვალი | პოლიეთერი ქსოვილზე | რაიონის ქსოვილზე | Viscose ქსოვილზე | ნართი | ჩანთები | თეთრეულის ქსოვილი | აბ...
  • Mumbai
  • ინდოეთი
supplyautonomy.com/kanishkenterprises.in
We are engaged in wholesaling, exporting supplying a wide array of textile products. We specialize in excellent range of textile products like Yarn, Fabric and Made Ups. Fabricated in accordance... დაწვრილებით »
  • შარვალი და შარვალი | ნაწარმი | ნართი | საბნები და eiderdowns, ბუმბული შევსებული...
  • Chandigarh
  • ინდოეთი
supplyautonomy.com/ramswarooprattanlal.in
  • ნაქსოვი ქსოვილისაგან | ნეილონის ქსოვილი | პოლიეთერი ქსოვილზე | ნართი | პოლიეთერი ძაფები | ფეხსაცმელი | Embroidery ხელოვნ...
  • Delhi
  • ინდოეთი
supplyautonomy.com/kaviramexim.in
  • ახალი ქოქოსის | ტექსტილის ნაწარმი | შარვალი და შარვალი | ნაქსოვი ქსოვილისაგან | ნაწარმი | ნართი | ტანსაცმელი, ქალთა | ტა...
  • Coimbatore
  • ინდოეთი
supplyautonomy.com/interglobal.in
We are a general trading company, operating from our offices in India, Dubai and China We are mainly dealing in Building materialslike timber, plywood, veneer, doors, moulded door skins, veneered... დაწვრილებით »
  • კაკაო ლობიო | ნართი | აგრო პროდუქტები და საქონელს...
  • Ahmedabad
  • ინდოეთი
supplyautonomy.com/santoshiexports.in
Exporter of Raw Cotton, Yarns, Agriculture Products, Handicrafts (Silver & Metal) Articles.
  • მოვაჭრეები, ნედლეული ბამბა | ობიექტებში, ნედლეული ბამბა | ნართი | ხელის შეკრული ხალიჩების | ხელის tufted ხალიჩების | აგრ...
  • Khamgaon
  • ინდოეთი
supplyautonomy.com/guriplik.tr
Gur Iplik Industry and Trade Incorporated Business, starded producing first class acrylic yarn in 2008 with a capacity of 20 tons/day, a closed area of 40.000 sqm, and 250 employees. The company is... დაწვრილებით »
  • თემა და ძაფებისაგან, ხელოვნური და სინთეზური | 100% აკრილის ძაფები...
  • Gaziantep
  • თურქეთი
supplyautonomy.com/grodnokhimvoloknojsc.by
JSC Grodno Khimvolokno is the large manufacturer of a polyamide thread, including twisted; polyester threads HMLS, cord hard and impregnated fabric; technical fabric ЕР; polyamide textured threads B... დაწვრილებით »
  • თემა და ძაფებისაგან, ხელოვნური და სინთეზური | თემა და ძაფებისაგან...
  • Sopot
  • ბელორუსია