Loading...
Matokeo ya: Nishati ya jua bidhaa na vifaa vya
Kupatikana 6323 makampuni
supplyautonomy.com/hincoopower.ph
Hincoo Power offers comprehensive solutions that hugely augment the peak power shortage, given the development of the local economy, industry, and commerce. It has supported the rapid growth of the... Soma Zaidi »
- Vituo vya nguvu, nishati ya jua | Nguvu ya jua kupanda, photovoltaic kiini | Modules | Nishati ya jua kwa trackers...
- Shenzhen
- China
supplyautonomy.com/placasar1es.es
supplyautonomy.com/geospec.in
We are into business of providing turnkey solutions in Lighting Green Energy Solutions viz. Solar Wind energy solutions. We are operating in both Goverment as well as private sector have... Soma Zaidi »
- Umeme vipengele | Incandescent taa | Taa na floodlights, asetilini | Taa, mafuta ya | Roho taa | Gesi taa | Mshumaa taa...
- Gurgaon
- India
supplyautonomy.com/apexenterprises.in
You will pleased to know that we professional in setup second hand Rolling mill,Induction or Arc furnace, Industrial Machinery and electrical items such as all type of motors(DC AC),Turbines,water... Soma Zaidi »
- Miradi ya ujenzi | Insulation vifaa | Wajenzi 'zana | Vifaa vya | Pochi | Elekezi na overcapping vidonge, plastiki |...
- Secunderabad
- India
supplyautonomy.com/indotechindustrialsolutionspvt.in
We are a diversified technology leader, providing integrated automation and software solutions to various industries like technology, power, service sector, mobile pstn line operators,... Soma Zaidi »
- Maziwa ya unga | Telecommunications - vifaa na mifumo ya | Elektroniki vifaa | Umeme vipengele | Umeme na elektroniki...
- Pune
- India
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Soma Zaidi »
- Usalama wa bidhaa mawakala | Uhamisho kuchapa | Sindano ukingo huduma, chuma | Insulation vifaa | Desturi kubuni...
- Amravati
- India
supplyautonomy.com/laxmiindustries.in
Manufacturer and Exporters of Three Wheeler, Hand Operated Tricycles, Wheelchair, Walker, Crutches, Hearing Aids and Mopeds/Motor Cycles with Three Wheeler and Both Side Wheel Attachment System.
- Fabricators, alumini | Wajenzi 'zana | Mpira valves | kipepeo valves | Ngano | Matibabu samani | Nguo kuhusiana na...
- Indore
- India
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Soma Zaidi »
- Usalama wa bidhaa mawakala | Uhamisho kuchapa | Sindano ukingo huduma, chuma | Insulation vifaa | Desturi kubuni...
- Mumbai
- India
supplyautonomy.com/yessolarsolutionscary.us
At Yes Solar Solutions, our unique advantage lies in our commitment to quality and the craftsmanship we bring to each project. We are the only NABCEP Accredited solar installer in North Carolina and... Soma Zaidi »
- Nishati ya jua jopo ufungaji | Nishati ya jua jopo paa-kufunika kazi | Solpaneler | Nishati ya jua jopo | Nishati ya...
- Cary
- Marekani
supplyautonomy.com/basantproductsindia.in
INTRODUCTION
M / S Basant Products (India) is a prestigious award winner for quality Marketing and three BIS licenses holder, manufacturer and Exporter of Diesel Generating Sets, Diesel Engines,... Soma Zaidi »
- Nyingine shirika la huduma | Dizeli jenereta | Umeme motor | Sekta ya chakula kupanda na kolena vifaa | Vizuri kuchimba...
- Agra
- India
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Soma Zaidi »
- Usalama wa bidhaa mawakala | Uhamisho kuchapa | Sindano ukingo huduma, chuma | Insulation vifaa | Desturi kubuni...
- Faridabad
- India
supplyautonomy.com/miplmanoharinternationalpvt.in
MIPL, one of the worlds most trusted brands, is a name with a long history that powers itself into new ventures. This trust extends to a series of products, services and solutions that cover diverse... Soma Zaidi »
- Mpira valves | kipepeo valves | Bidhaa za plastiki | Nyingine ufungaji vifaa | Mazao ya chakula, waya | Quartz jiwe |...
- Ahmedabad
- India
supplyautonomy.com/citadelarchitecturalsolutionspvt.in
Citadel Architectural Solutions Pvt. Ltd., is an innovative company headquartered in Mumbai. Citadel works with a number of innovative roofing and cladding products and solutions, as well as... Soma Zaidi »
- Jitakasa hewa | Paa | Mapambo ya juu-shinikizo laminates / hpl | Bidhaa za plastiki | Plastiki filamu | Elektroniki...
- Mumbai
- India
supplyautonomy.com/babaenterprises.in
Baba Enterprises is a name to reckon with the spectrum of latest garment accessories. The business avenues of our company comprises of manufacturing, supplying and exporting a wide range of apparel... Soma Zaidi »
- Miradi ya ujenzi | Wajenzi 'zana | Kuwepo | Kikabila mavazi | Vitambaa | Vazi rivets | Umeme vipengele | Vizuri...
- New Delhi
- India
supplyautonomy.com/ronakgroup.in
Ronak Rocks Pvt. Ltd. is a professionally managed organization engaged in the production of a variety of stone products in various sizes and finishes. Our range of natural stone and natural building... Soma Zaidi »
- Afya miradi | Mavazi ya kubuni huduma | Miscellaneous jengo jiwe | Umeme vipengele | Packs betri | Mbolea | Dawa makala...
- Vadodara
- India
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade.
It has its offices at various places in India and has its global... Soma Zaidi »
- Mashine tow usindikaji huduma | Nguo taka usindikaji huduma, pamba | Nguo taka usindikaji huduma, nywele | Nguo taka...
- Mumbai
- India
supplyautonomy.com/china.cn
supplyautonomy.com/jayagenciez.in
Jay Agenciez is an authorized agent in India for some of the worlds most famous Brands of Industrial Products. We are mainly into the Import and Export supplies of Industrial Consumables which are... Soma Zaidi »
- Insulation vifaa | Kusafisha vifaa | Bidhaa za plastiki | Lim na mkanda | Vifaa vya kulehemu | Mazao ya chakula, waya |...
- Surat
- India
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Soma Zaidi »
- Usalama wa bidhaa mawakala | Uhamisho kuchapa | Sindano ukingo huduma, chuma | Insulation vifaa | Desturi kubuni...
- Ahmedabad
- India
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Soma Zaidi »
- Usalama wa bidhaa mawakala | Uhamisho kuchapa | Sindano ukingo huduma, chuma | Insulation vifaa | Desturi kubuni...
- Bardoli
- India
supplyautonomy.com/scientechtechnologiespvt.in
Scientech Technologies Pvt. Ltd. is an ISO 9001:2008 certified company that has a strong presence in educational, health care, environmental and industrial sectors. With more than 550 diverse... Soma Zaidi »
- Umeme na elektroniki bidhaa | Nyingine nguvu vifaa | Viwanda umeme | Vizuri kuchimba visima mashine | Umeme na vifaa...
- Indore
- India
supplyautonomy.com/spaceagesecuritysystems.in
Spaceage Security Systems Ltd. is an exporter of India Solar Lamps products. With a well management system, Sisale strives to offer the best quality products and service as possible as we can, as... Soma Zaidi »
- Namba ya seti | Telecommunications - vifaa na mifumo ya | Elektroniki vipengele | Elektroniki vifaa | Umeme vipengele |...
- Delhi
- India
supplyautonomy.com/uniquecombustion.in
Company Brief Empowered with technological expertise and service support of a highly skilled workforce, we, Unique Combustion, have emerged as one of the leading manufacturers, exporters, importers,... Soma Zaidi »
- Biashara ya usafiri fedha | Boiler sehemu | Burners, viwanda | Umeme motor | Umeme na vifaa vya umeme | Nishati ya jua...
- New Delhi
- India
supplyautonomy.com/trademaxenterprise.in
TradeMax Enterprise has been founded by a team of professionals with rich experience in international business and Trading. Our team has worked for years in sourcing of products and... Soma Zaidi »
- Mazulia | Cable tezi | Umeme motor | Ufungaji mitambo ya | Nguo | Coir bidhaa | Mpira & mpira bidhaa | Nishati ya jua...
- Mumbai
- India
supplyautonomy.com/ganpatielectricalspvt.in
Profile
Established in the year 1998, Ganpati Electricals Pvt. Ltd. is amongst the leading manufacturers and traders of wide range of electrical equipment. We specialize in Servo Voltage... Soma Zaidi »
- Makandarasi uzalishaji umeme na sekta ya usambazaji | Nyingine kubuni huduma | Terminal vitalu | Dizeli jenereta |...
- Delhi
- India
supplyautonomy.com/crystalhomeappliancesindia.in
Ask it and you have it with CRYSTAL HOME APPLIANCES (INDIA) presenting a wide range of MLM products with guaranteed best price. We are one of the biggest names engaged in the domain of offering ... Soma Zaidi »
- Desturi programu ya maendeleo ya huduma | Kusafisha vifaa | Mashirika yasiyo ya pombe na vinywaji | Vitambaa | Pochi |...
- Jaipur
- India
supplyautonomy.com/acmeinternational1.in
Established in 2003. Acme international is an exporters of machinery equipments for jewellery industries. We always strive to bring the latest and the best, keeping pace with
Technology, time and... Soma Zaidi »
- Hewa mapazia | Bidhaa za plastiki | Umeme na elektroniki bidhaa | Tanuu kwa vito | Rolling Mills kwa vito | Stamping...
- Mumbai
- India
supplyautonomy.com/srisaienterprises.in
EXPORT PACKERS in Gujarat
QUALITY PACKERS/vinyl packers/anti corrosive packaging
DISTRIBUTOR OF Valvoline Cummins ltd. Tectyl products.
Industrial lubricants distributors
Polka dotted hand... Soma Zaidi »
- Makandarasi uzalishaji umeme na sekta ya usambazaji | Courier huduma | Mpira valves | kipepeo valves | Magunia na...
- Warangal
- India
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... Soma Zaidi »
- Nishati ya jua uzalishaji | Nishati ya jua washauri | Lithiamu ackumulatorer | Nishati ya jua bidhaa na vifaa vya |...
- Gurgaon
- India
supplyautonomy.com/zenithfilms.sg
At Zenith Window Films, we offer a spectrum of of 3m solar window films, 3m whiteboard films for home and window tinting in Singapore at cheap prices. We are dedicated to offer excellent service to... Soma Zaidi »
- Nishati ya jua bidhaa na vifaa vya
- singapore
- Singapoo