Loading...
Kết quả tìm kiếm cho: Năng lượng mặt trời sản phẩm & thiết bị
Công ty 6323 được tìm thấy
supplyautonomy.com/hincoopower.ph
Hincoo Power offers comprehensive solutions that hugely augment the peak power shortage, given the development of the local economy, industry, and commerce. It has supported the rapid growth of the... Đọc thêm »
- Nhà máy điện, năng lượng mặt trời | Nhà máy điện năng lượng mặt trời, tế bào quang điện | Module | Máy theo dõi năng lượ...
- Shenzhen
- Trung Quốc
supplyautonomy.com/placasar1es.es
supplyautonomy.com/geospec.in
We are into business of providing turnkey solutions in Lighting Green Energy Solutions viz. Solar Wind energy solutions. We are operating in both Goverment as well as private sector have... Đọc thêm »
- Các thành phần điện | Bóng đèn sợi đốt | Đèn và bóng đèn pha, axetylen | Đèn, dầu | Đèn tinh thần | Đèn khí | Đèn nến | ...
- Gurgaon
- Ấn Độ
supplyautonomy.com/apexenterprises.in
You will pleased to know that we professional in setup second hand Rolling mill,Induction or Arc furnace, Industrial Machinery and electrical items such as all type of motors(DC AC),Turbines,water... Đọc thêm »
- Công trình dự án | Vật liệu cách nhiệt | Công cụ xây dựng ' | Văn phòng phẩm | Ví | Đóng nắp và overcapping viên nang, n...
- Secunderabad
- Ấn Độ
supplyautonomy.com/indotechindustrialsolutionspvt.in
We are a diversified technology leader, providing integrated automation and software solutions to various industries like technology, power, service sector, mobile pstn line operators,... Đọc thêm »
- Sữa bột | Viễn thông - thiết bị và hệ thống | Nguồn cung cấp điện tử | Các thành phần điện | Sản phẩm điện và điện tử | ...
- Pune
- Ấn Độ
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Đọc thêm »
- An ninh Đại lý sản phẩm | Chuyển In ấn | Dịch vụ tiêm đúc, kim loại | Vật liệu cách nhiệt | Tùy chỉnh thiết kế lò xo | K...
- Amravati
- Ấn Độ
supplyautonomy.com/laxmiindustries.in
Manufacturer and Exporters of Three Wheeler, Hand Operated Tricycles, Wheelchair, Walker, Crutches, Hearing Aids and Mopeds/Motor Cycles with Three Wheeler and Both Side Wheel Attachment System.
- Chế tạo, nhôm | Công cụ xây dựng ' | Van bi | Van bướm | Lúa mì | Đồ nội thất y tế | Các sản phẩm liên quan đến dệt may ...
- Indore
- Ấn Độ
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Đọc thêm »
- An ninh Đại lý sản phẩm | Chuyển In ấn | Dịch vụ tiêm đúc, kim loại | Vật liệu cách nhiệt | Tùy chỉnh thiết kế lò xo | K...
- Mumbai
- Ấn Độ
supplyautonomy.com/yessolarsolutionscary.us
At Yes Solar Solutions, our unique advantage lies in our commitment to quality and the craftsmanship we bring to each project. We are the only NABCEP Accredited solar installer in North Carolina and... Đọc thêm »
- Năng lượng mặt trời lắp đặt bảng điều khiển năng lượng | Năng lượng mặt trời bảng điều khiển mái che làm việc | Tấm pin ...
- Cary
- Hoa Kỳ
supplyautonomy.com/basantproductsindia.in
INTRODUCTION
M / S Basant Products (India) is a prestigious award winner for quality Marketing and three BIS licenses holder, manufacturer and Exporter of Diesel Generating Sets, Diesel Engines,... Đọc thêm »
- Cơ quan Dịch vụ khác | Máy phát điện diesel | Động cơ điện | Cây công nghiệp thực phẩm và thiết bị nes | Máy móc thiết b...
- Agra
- Ấn Độ
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Đọc thêm »
- An ninh Đại lý sản phẩm | Chuyển In ấn | Dịch vụ tiêm đúc, kim loại | Vật liệu cách nhiệt | Tùy chỉnh thiết kế lò xo | K...
- Faridabad
- Ấn Độ
supplyautonomy.com/miplmanoharinternationalpvt.in
MIPL, one of the worlds most trusted brands, is a name with a long history that powers itself into new ventures. This trust extends to a series of products, services and solutions that cover diverse... Đọc thêm »
- Van bi | Van bướm | Sản phẩm nhựa | Vật liệu bao bì khác | Mặt hàng chủ lực, dây | Đá thạch anh | Các loại hạt | Bằng th...
- Ahmedabad
- Ấn Độ
supplyautonomy.com/citadelarchitecturalsolutionspvt.in
Citadel Architectural Solutions Pvt. Ltd., is an innovative company headquartered in Mumbai. Citadel works with a number of innovative roofing and cladding products and solutions, as well as... Đọc thêm »
- Máy lọc không khí | Mui xe | Áp suất cao trang trí Laminates / HPL | Sản phẩm nhựa | Nhựa Film | Điện tử Dấu hiệu | Năng...
- Mumbai
- Ấn Độ
supplyautonomy.com/babaenterprises.in
Baba Enterprises is a name to reckon with the spectrum of latest garment accessories. The business avenues of our company comprises of manufacturing, supplying and exporting a wide range of apparel... Đọc thêm »
- Công trình dự án | Công cụ xây dựng ' | Trang trí nội thất | Dân tộc may | Vải | May mặc đinh tán | Các thành phần điện ...
- New Delhi
- Ấn Độ
supplyautonomy.com/ronakgroup.in
Ronak Rocks Pvt. Ltd. is a professionally managed organization engaged in the production of a variety of stone products in various sizes and finishes. Our range of natural stone and natural building... Đọc thêm »
- Y tế dự án | Trang phục Dịch vụ thiết kế | Đá xây dựng khác | Các thành phần điện | Pin Gói | Phân bón | Bài viết dược p...
- Vadodara
- Ấn Độ
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade.
It has its offices at various places in India and has its global... Đọc thêm »
- Dịch vụ xử lý máy kéo | Dịch vụ xử lý chất thải dệt may, len | Dịch vụ xử lý chất thải dệt may, tóc | Dịch vụ xử lý chất...
- Mumbai
- Ấn Độ
supplyautonomy.com/china.cn
supplyautonomy.com/jayagenciez.in
Jay Agenciez is an authorized agent in India for some of the worlds most famous Brands of Industrial Products. We are mainly into the Import and Export supplies of Industrial Consumables which are... Đọc thêm »
- Vật liệu cách nhiệt | Thiết bị làm sạch | Sản phẩm nhựa | Chất kết dính và băng | Thiết bị hàn | Mặt hàng chủ lực, dây |...
- Surat
- Ấn Độ
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Đọc thêm »
- An ninh Đại lý sản phẩm | Chuyển In ấn | Dịch vụ tiêm đúc, kim loại | Vật liệu cách nhiệt | Tùy chỉnh thiết kế lò xo | K...
- Ahmedabad
- Ấn Độ
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Đọc thêm »
- An ninh Đại lý sản phẩm | Chuyển In ấn | Dịch vụ tiêm đúc, kim loại | Vật liệu cách nhiệt | Tùy chỉnh thiết kế lò xo | K...
- Bardoli
- Ấn Độ
supplyautonomy.com/scientechtechnologiespvt.in
Scientech Technologies Pvt. Ltd. is an ISO 9001:2008 certified company that has a strong presence in educational, health care, environmental and industrial sectors. With more than 550 diverse... Đọc thêm »
- Sản phẩm điện và điện tử | Power Supplies | Cung cấp điện c | Máy móc thiết bị khoan giếng | Thiết bị đ...
- Indore
- Ấn Độ
supplyautonomy.com/spaceagesecuritysystems.in
Spaceage Security Systems Ltd. is an exporter of India Solar Lamps products. With a well management system, Sisale strives to offer the best quality products and service as possible as we can, as... Đọc thêm »
- Máy điện thoại | Viễn thông - thiết bị và hệ thống | Linh kiện điện tử | Nguồn cung cấp điện tử | Các thành phần điện | ...
- Delhi
- Ấn Độ
supplyautonomy.com/uniquecombustion.in
Company Brief Empowered with technological expertise and service support of a highly skilled workforce, we, Unique Combustion, have emerged as one of the leading manufacturers, exporters, importers,... Đọc thêm »
- Kinh doanh Du lịch trọn gói | Bộ phận lò hơi | Đốt, công nghiệp | Động cơ điện | Thiết bị điện và điện tử | Năng lượng m...
- New Delhi
- Ấn Độ
supplyautonomy.com/trademaxenterprise.in
TradeMax Enterprise has been founded by a team of professionals with rich experience in international business and Trading. Our team has worked for years in sourcing of products and... Đọc thêm »
- Thảm | Các tuyến cáp | Động cơ điện | Máy móc bao bì | Quần áo | Sản phẩm xơ dừa | Sản phẩm cao su và cao su | Năng lượn...
- Mumbai
- Ấn Độ
supplyautonomy.com/ganpatielectricalspvt.in
Profile
Established in the year 1998, Ganpati Electricals Pvt. Ltd. is amongst the leading manufacturers and traders of wide range of electrical equipment. We specialize in Servo Voltage... Đọc thêm »
- Nhà thầu đến việc sản xuất điện và ngành công nghiệp phân phối | Thiết kế Dịch vụ khác | Khối thiết bị đầu cuối | Máy ph...
- Delhi
- Ấn Độ
supplyautonomy.com/crystalhomeappliancesindia.in
Ask it and you have it with CRYSTAL HOME APPLIANCES (INDIA) presenting a wide range of MLM products with guaranteed best price. We are one of the biggest names engaged in the domain of offering ... Đọc thêm »
- Dịch vụ phát triển phần mềm tùy chỉnh | Thiết bị làm sạch | Đồ uống không cồn | Vải | Ví | Sản phẩm điện và điện tử | Hạ...
- Jaipur
- Ấn Độ
supplyautonomy.com/acmeinternational1.in
Established in 2003. Acme international is an exporters of machinery equipments for jewellery industries. We always strive to bring the latest and the best, keeping pace with
Technology, time and... Đọc thêm »
- Màn chắn không khí | Sản phẩm nhựa | Sản phẩm điện và điện tử | Lò cho đồ trang sức | Máy cán cho đồ trang sức | Dập thi...
- Mumbai
- Ấn Độ
supplyautonomy.com/srisaienterprises.in
EXPORT PACKERS in Gujarat
QUALITY PACKERS/vinyl packers/anti corrosive packaging
DISTRIBUTOR OF Valvoline Cummins ltd. Tectyl products.
Industrial lubricants distributors
Polka dotted hand... Đọc thêm »
- Nhà thầu đến việc sản xuất điện và ngành công nghiệp phân phối | Dịch vụ chuyển phát nhanh | Van bi | Van bướm | Bao và ...
- Warangal
- Ấn Độ
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... Đọc thêm »
- Sản xuất năng lượng mặt trời | Chuyên gia tư vấn năng lượng mặt trời | Ắc quy lithium | Năng lượng mặt trời sản phẩm & t...
- Gurgaon
- Ấn Độ
supplyautonomy.com/zenithfilms.sg
At Zenith Window Films, we offer a spectrum of of 3m solar window films, 3m whiteboard films for home and window tinting in Singapore at cheap prices. We are dedicated to offer excellent service to... Đọc thêm »
- Năng lượng mặt trời sản phẩm & thiết bị
- singapore
- Singapore