Loading...
Որոնման արդյունքները: Տպագրություն եւ գրաֆիկա սարքավորումներ
Գտնվել է X կազմակերպությունsupplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Կարդալ ավելին »
- Bag կատարելու մեքենաներ | Տպագրություն եւ գրաֆիկա սարքավորումներ
- Ruian
- Չինաստան
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ | Այլ նյութական մշակման սարքավորումներ...
- Wenzhou
- Չինաստան
supplyautonomy.com/acmemachinerycompanypvt.in
Into Manufacturing of Paper Corrugated Carton Production Line, print finishing machines since last three decades with excellent customer base using range of our machine.
The state of art... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ | Փաթեթավորում մեքենաներ
- Mumbai
- Հնդկաստան
supplyautonomy.com/siadgroupsrl.it
SIAD GROUP srl provides end to end solutions for the new business of printing. We provide services and products including consulting, workflow and finishing printing equipment to match the... Կարդալ ավելին »
- Hot կնքումը նրբաթիթեղ | Տպագրություն եւ գրաֆիկա սարքավորումներ
- Arese
- Իտալիա
supplyautonomy.com/ishaninternational.in
we leading manufacturer of plastic printing machine and bag making machines viz., Rotogravure Printing Machine, Flexo Printing Machine, Bag making machine, side sealing machine, Slitting... Կարդալ ավելին »
- Bag կատարելու մեքենաներ | Տպագրություն եւ գրաֆիկա սարքավորումներ
- Ahmedabad
- Հնդկաստան
supplyautonomy.com/junsheng.cn
Our company is located in Dongguang County, Hebei Province, China. We are specialized in manufacturing all kinds of water base ink printing slotting die-cutting machines and whole sets of carton... Կարդալ ավելին »
- Մաքրման սարքավորումներ | Տպագրություն եւ գրաֆիկա սարքավորումներ | Փաթեթավորում մեքենաներ | Օժանդակ փաթեթավորման սարքավոր...
- Cangzhou
- Չինաստան
supplyautonomy.com/zhejiangtianfengplasticmachineryplant.cn
Zhejiang Tianfeng Plastic Machinery Plant is a global supplier of standard and custom-engineered products and systems. Our products serve the complete range of PP/PE woven bag machine, leno mesh bag... Կարդալ ավելին »
- Bag կատարելու մեքենաներ | Տպագրություն եւ գրաֆիկա սարքավորումներ
- Wenzhou
- Չինաստան
supplyautonomy.com/vishvaeximpvt.in
Manufacturer and Exporters of Roto Gravure Printing Machine, Flexo Graph Printing Machine, Laminators (Solvent less), Laminators (Base), Extrusion Machines, Small Packaging Machinery, Core Cutting... Կարդալ ավելին »
- Հանքերի | Տելեքս սարքավորումներ | Տպագրություն եւ գրաֆիկա սարքավորումներ | Փաթեթավորում մեքենաներ...
- Ahmedabad
- Հնդկաստան
supplyautonomy.com/shanghaipripackmachineryco.cn
Shanghai Pripack Machinery Co., Ltd. is a company that specializes in providing printing & packaging machinery and production line. Owning experienced employees and cooperating with many... Կարդալ ավելին »
- Ալյումինե ALLOYS | Տպագրություն եւ գրաֆիկա սարքավորումներ | Փաթեթավորում մեքենաներ...
- Shanghai
- Չինաստան
supplyautonomy.com/bajajprintpackmachineriespvt.in
We supply hologram Machinery to produce holograms from hologram master shooting to die-cutting, includes hologram master shooting system (2D / 3D master and Dot-matrix master) , recombination... Կարդալ ավելին »
- Այլ հագուստի մեքենաներ | Տպագրություն եւ գրաֆիկա սարքավորումներ | Փաթեթավորում մեքենաներ...
- New Delhi
- Հնդկաստան
supplyautonomy.com/mmmauenhandelsgesellschaftmbh.de
MMM established in 1986 are specialists in matches industry.
Combination of integrity, high business ethics with sound consulatation, makes us your number one souce in Match Machinery and Material... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ | Այլ օգտագործված մեքենաներ | Ծխախոտ եւ ծխողները իրեր...
- Hamburg
- Գերմանիա
supplyautonomy.com/natrajcorrugatingmachinerycompany.in
India's leading manufacturer and exporter of paper corrugated board and box making machinery since1955,Brand SUPER NATARAJA FORMERLY KNOWN AS NATARAJA. company have the experience of making... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ | Այլ նյութական մշակման սարքավորումներ | Փաթեթավորում մեքենաներ...
- New Delhi
- Հնդկաստան
supplyautonomy.com/seniormachineryco.in
About Us
Promoted by a Team of qualified professionals. Highly experienced in the machinery filed.
We are 25 years old, out of which 15 years we were manufacturing Printing related... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ | Թուղթ մշակման սարքավորումներ մասեր | Փաթեթավորում մեքենաներ...
- Pune
- Հնդկաստան
supplyautonomy.com/alphagraphics737.us
At Alphagraphics 737 Grapevine, TX we have the skills and tools to help brand your company effectively. Call us for printing services, blueprint, car wraps, signs and banners.
- Գրաֆիկա Ավտոմատացված աշխատատեղեր | Տպագրություն եւ գրաֆիկա սարքավորումներ | Նախագիծ, պատճենահանման մեքենաներ | Տպիչներ ե...
- Grapevine
- Ամէրիկայի Միացյալ Նահանգնէր
supplyautonomy.com/webcoindustries.in
supplyautonomy.com/lapraco.in
For more than 38 years, Lapra Co. has been constantly demonstrating its innovative
power and is today one of the leading companies in the area of flexible packaging
Our passion for ... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ | Rotogravure տպագրություն մեքենա...
- New Delhi
- Հնդկաստան
supplyautonomy.com/multipresssrl.it
- STAMPING, PLASTICS - սարքավորումներ | Ներարկման, PLASTICS - սարքավորումներ | Պլաստմասսա - Արդյունաբերական մեքենաներ եւ ս...
- Ponte San Marco
- Իտալիա
supplyautonomy.com/urstechnologyofindia.in
Breaking new grounds in the domain of printers and allied machines, we, URS Technology Of India, have captured a huge market share. Our products are of high quality and meet the industrial quality... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ | PRINTING INK & PAINT հումք
- Kolkata
- Հնդկաստան
supplyautonomy.com/suntrading.in
supplyautonomy.com/kptechmachineindiapvt.in
- Գործվածքներ | Պայուսակներ | Դրամապանակներ | Տպագրություն եւ գրաֆիկա սարքավորումներ | Եռակցման սարքավորումներ | Ոչ հյուսվ...
- Ahmedabad
- Հնդկաստան
supplyautonomy.com/hicmachineryco.in
- Էլեկտրոնային արտադրանքներ | Տպագրություն եւ գրաֆիկա սարքավորումներ | Փաթեթավորում մեքենաներ | Տպիչներ եւ մատյաններ...
- Amritsar
- Հնդկաստան
supplyautonomy.com/chinacangzhoujiajiamachinerymanufacture.cn
- Շինարարներ 'գործիքներ | Ավտոմեքենանաների Էլեկտրական եւ էլեկտրոնային սարքավորումներ | Տպագրություն եւ գրաֆիկա սարքավորում...
- Cangzhou
- Չինաստան
supplyautonomy.com/babrahindustrialcorporation.in
About Babrah Industrial CorporationWe, Babrah Industrial Corporation, are meeting the bulk and urgent orders of our valued clients via our robust production facilities, supported distribution network... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ
- Amritsar
- Հնդկաստան
supplyautonomy.com/carmelengineering.in
We are manufacturer, supplier and exporter of flexo printing machinery such as flexographic printing machine and apart from this we also deals into non woven printing machine, lamination machine,... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ
- Madurai
- Հնդկաստան
supplyautonomy.com/universalinksvarnishplimited.in
In the field of Inks & Varnish, we 'Universal Inks & Varnish (P) Ltd.' are leading the market since 1981 as a renowned manufacturer, exporter, importer and supplier. Our company has... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ | Տպագրական եւ հարակից արտադրանքներ | PRINTING INK & PAINT հումք...
- Delhi
- Հնդկաստան
supplyautonomy.com/ramanindustries.in
In the year of 1971 the company was established and engaged itself as a paper converterand susequently in the year of 1973 it had started Machine manufacturing unit. Now-a-days it has covered area... Կարդալ ավելին »
- Պլաստիկ laminating մեքենաներ | Տպագրություն եւ գրաֆիկա սարքավորումներ...
- Kolkata
- Հնդկաստան
supplyautonomy.com/msenterprises20.in
To offer a comprehensive product line meeting the engineering needs of our clients, M.S. Enterprises was established in the year 1975. We are renowned in the industry as leading Manufacturer,... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ
- Faridabad
- Հնդկաստան
supplyautonomy.com/asindustrialconsultingservices.in
Catering a range of integrated technical consultancy services to a varied range of industrial houses for setting up new projects in India or abroad...A.S. Industrial Consulting Services, thereafter... Կարդալ ավելին »
- Տպագրություն եւ գրաֆիկա սարքավորումներ
- Gurgaon
- Հնդկաստան
supplyautonomy.com/ruiancambridgemachinery.cn
Located in RUIAN, the well-known Soft Package City of China, Ruian CAMBRIDGE MACHINE I/E Company pours big energy in package machinery. In 2008, we got the foot in manufacturing of Plastic Film... Կարդալ ավելին »
- Bag կատարելու մեքենաներ | Տպագրություն եւ գրաֆիկա սարքավորումներ
- Ruian
- Չինաստան
supplyautonomy.com/marsonsprintgrafmachinespvt.in
- Սոսինձներ եւ ժապավեն | Տպագրություն եւ գրաֆիկա սարքավորումներ | Rotogravure տպագրություն մեքենա | Փաթեթավորում մեքենաներ...
- Mumbai
- Հնդկաստան