Mga Resulta ng Paghahanap para sa: Solar mga produkto at kagamitan
Nahanap 6323 kumpanyasupplyautonomy.com/hincoopower.ph
Hincoo Power offers comprehensive solutions that hugely augment the peak power shortage, given the development of the local economy, industry, and commerce. It has supported the rapid growth of the... Basahin Higit pang mga »
- Power istasyon, solar enerhiya | Solar kapangyarihan halaman, photovoltaic cell | Mga Module | Solar trackers para sa...
- Shenzhen
- China
supplyautonomy.com/placasar1es.es
supplyautonomy.com/geospec.in
We are into business of providing turnkey solutions in Lighting Green Energy Solutions viz. Solar Wind energy solutions. We are operating in both Goverment as well as private sector have... Basahin Higit pang mga »
- Electrical mga bahagi | Maliwanag na maliwanag lamp | Lampara at floodlights, asetileno | Lampara, langis | Espiritu...
- Gurgaon
- India
supplyautonomy.com/apexenterprises.in
You will pleased to know that we professional in setup second hand Rolling mill,Induction or Arc furnace, Industrial Machinery and electrical items such as all type of motors(DC AC),Turbines,water... Basahin Higit pang mga »
- Construction mga proyekto | Pagkakabukod materyales | Builders 'tool | Mga kagamitan sa pagsulat | Wallets | Pag-cap at...
- Secunderabad
- India
supplyautonomy.com/indotechindustrialsolutionspvt.in
We are a diversified technology leader, providing integrated automation and software solutions to various industries like technology, power, service sector, mobile pstn line operators,... Basahin Higit pang mga »
- Gatas pulbos | Telecommunications - kagamitan at mga sistema | Electronic supplies | Electrical mga bahagi |...
- Pune
- India
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Basahin Higit pang mga »
- Security produkto ahente | Maglipat ng pag-print | Pag-iiniksyon paghubog serbisyo, metal | Pagkakabukod materyales |...
- Amravati
- India
supplyautonomy.com/laxmiindustries.in
Manufacturer and Exporters of Three Wheeler, Hand Operated Tricycles, Wheelchair, Walker, Crutches, Hearing Aids and Mopeds/Motor Cycles with Three Wheeler and Both Side Wheel Attachment System.
- Fabricators, aluminyo | Builders 'tool | Ball Valve | Butterfly Valve | Trigo | Medikal furniture | Textile kaugnay na...
- Indore
- India
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Basahin Higit pang mga »
- Security produkto ahente | Maglipat ng pag-print | Pag-iiniksyon paghubog serbisyo, metal | Pagkakabukod materyales |...
- Mumbai
- India
supplyautonomy.com/yessolarsolutionscary.us
At Yes Solar Solutions, our unique advantage lies in our commitment to quality and the craftsmanship we bring to each project. We are the only NABCEP Accredited solar installer in North Carolina and... Basahin Higit pang mga »
- Solar enerhiya panel ng pag-install | Solar panel ng roof-sumasaklaw sa trabaho | Solar panel | Solar panel | Solar mga...
- Cary
- Estados Unidos
supplyautonomy.com/basantproductsindia.in
INTRODUCTION
M / S Basant Products (India) is a prestigious award winner for quality Marketing and three BIS licenses holder, manufacturer and Exporter of Diesel Generating Sets, Diesel Engines,... Basahin Higit pang mga »
- Iba pang mga serbisyo ng ahensiya | Diesel generators | Motor na de koryente | Pagkain industriya halaman at equipment...
- Agra
- India
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Basahin Higit pang mga »
- Security produkto ahente | Maglipat ng pag-print | Pag-iiniksyon paghubog serbisyo, metal | Pagkakabukod materyales |...
- Faridabad
- India
supplyautonomy.com/miplmanoharinternationalpvt.in
MIPL, one of the worlds most trusted brands, is a name with a long history that powers itself into new ventures. This trust extends to a series of products, services and solutions that cover diverse... Basahin Higit pang mga »
- Ball Valve | Butterfly Valve | Plastic mga produkto | Iba pang mga packaging mga materyales | Staples, wire | Kuwarts...
- Ahmedabad
- India
supplyautonomy.com/citadelarchitecturalsolutionspvt.in
Citadel Architectural Solutions Pvt. Ltd., is an innovative company headquartered in Mumbai. Citadel works with a number of innovative roofing and cladding products and solutions, as well as... Basahin Higit pang mga »
- Air purifiers | Bubong | Pampalamuti mataas na presyon ng laminates / hpl | Plastic mga produkto | Plastic film |...
- Mumbai
- India
supplyautonomy.com/babaenterprises.in
Baba Enterprises is a name to reckon with the spectrum of latest garment accessories. The business avenues of our company comprises of manufacturing, supplying and exporting a wide range of apparel... Basahin Higit pang mga »
- Construction mga proyekto | Builders 'tool | Muwebles | Ethnic kasuotan | Tela | Damit rivets | Electrical mga bahagi |...
- New Delhi
- India
supplyautonomy.com/ronakgroup.in
Ronak Rocks Pvt. Ltd. is a professionally managed organization engaged in the production of a variety of stone products in various sizes and finishes. Our range of natural stone and natural building... Basahin Higit pang mga »
- Kalusugan proyekto | Kasuotan disenyo mga serbisyo | Sari-saring gusaling bato | Electrical mga bahagi | Baterya pack |...
- Vadodara
- India
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade.
It has its offices at various places in India and has its global... Basahin Higit pang mga »
- Machine paghatak pagpoproseso ng mga serbisyo | Textile basura processing serbisyo, lana | Textile basura processing...
- Mumbai
- India
supplyautonomy.com/china.cn
supplyautonomy.com/jayagenciez.in
Jay Agenciez is an authorized agent in India for some of the worlds most famous Brands of Industrial Products. We are mainly into the Import and Export supplies of Industrial Consumables which are... Basahin Higit pang mga »
- Pagkakabukod materyales | Nililinis ang mga kagamitan | Plastic mga produkto | Pandikit at tape | hinang kagamitan |...
- Surat
- India
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Basahin Higit pang mga »
- Security produkto ahente | Maglipat ng pag-print | Pag-iiniksyon paghubog serbisyo, metal | Pagkakabukod materyales |...
- Ahmedabad
- India
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Basahin Higit pang mga »
- Security produkto ahente | Maglipat ng pag-print | Pag-iiniksyon paghubog serbisyo, metal | Pagkakabukod materyales |...
- Bardoli
- India
supplyautonomy.com/scientechtechnologiespvt.in
Scientech Technologies Pvt. Ltd. is an ISO 9001:2008 certified company that has a strong presence in educational, health care, environmental and industrial sectors. With more than 550 diverse... Basahin Higit pang mga »
- De-kuryente at mga produktong elektroniko | Iba pang mga kapangyarihan supplies | Pang-industriya supply ng...
- Indore
- India
supplyautonomy.com/spaceagesecuritysystems.in
Spaceage Security Systems Ltd. is an exporter of India Solar Lamps products. With a well management system, Sisale strives to offer the best quality products and service as possible as we can, as... Basahin Higit pang mga »
- Telepono ng mga hanay | Telecommunications - kagamitan at mga sistema | Electronic mga bahagi | Electronic supplies |...
- Delhi
- India
supplyautonomy.com/uniquecombustion.in
Company Brief Empowered with technological expertise and service support of a highly skilled workforce, we, Unique Combustion, have emerged as one of the leading manufacturers, exporters, importers,... Basahin Higit pang mga »
- Negosyo travel pakete | Boiler bahagi | Burner, pang-industriya | Motor na de koryente | De-kuryente at electronic...
- New Delhi
- India
supplyautonomy.com/trademaxenterprise.in
TradeMax Enterprise has been founded by a team of professionals with rich experience in international business and Trading. Our team has worked for years in sourcing of products and... Basahin Higit pang mga »
- Karpet | Cable glandula | Motor na de koryente | Packaging makinarya | Mga damit | Koye produkto | Goma at goma...
- Mumbai
- India
supplyautonomy.com/ganpatielectricalspvt.in
Profile
Established in the year 1998, Ganpati Electricals Pvt. Ltd. is amongst the leading manufacturers and traders of wide range of electrical equipment. We specialize in Servo Voltage... Basahin Higit pang mga »
- Kontratista sa koryente produksyon at pamamahagi industriya | Iba pang mga serbisyo ng disenyo | Terminal bloke |...
- Delhi
- India
supplyautonomy.com/crystalhomeappliancesindia.in
Ask it and you have it with CRYSTAL HOME APPLIANCES (INDIA) presenting a wide range of MLM products with guaranteed best price. We are one of the biggest names engaged in the domain of offering ... Basahin Higit pang mga »
- Custom software development mga serbisyo | Nililinis ang mga kagamitan | Non-alcoholic beverage | Tela | Wallets |...
- Jaipur
- India
supplyautonomy.com/acmeinternational1.in
Established in 2003. Acme international is an exporters of machinery equipments for jewellery industries. We always strive to bring the latest and the best, keeping pace with
Technology, time and... Basahin Higit pang mga »
- Air kurtina | Plastic mga produkto | De-kuryente at mga produktong elektroniko | Furnaces para sa mga alahas | Rolling...
- Mumbai
- India
supplyautonomy.com/srisaienterprises.in
EXPORT PACKERS in Gujarat
QUALITY PACKERS/vinyl packers/anti corrosive packaging
DISTRIBUTOR OF Valvoline Cummins ltd. Tectyl products.
Industrial lubricants distributors
Polka dotted hand... Basahin Higit pang mga »
- Kontratista sa koryente produksyon at pamamahagi industriya | Courier serbisyo | Ball Valve | Butterfly Valve | Sacks...
- Warangal
- India
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... Basahin Higit pang mga »
- Solar enerhiya produksyon | Solar enerhiya consultant | Lithium accumulators | Solar mga produkto at kagamitan | Solar...
- Gurgaon
- India
supplyautonomy.com/zenithfilms.sg
At Zenith Window Films, we offer a spectrum of of 3m solar window films, 3m whiteboard films for home and window tinting in Singapore at cheap prices. We are dedicated to offer excellent service to... Basahin Higit pang mga »
- Solar mga produkto at kagamitan
- singapore
- Singapore