Loading...
Резултати од пребарувањето за: Опрема за печатење и графички дизајн
Најде 277 компанииsupplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Прочитај повеќе »
- Торба правење машини | Опрема за печатење и графички дизајн
- Ruian
- Кина
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Прочитај повеќе »
- Опрема за печатење и графички дизајн | Друг материјал опрема за ракување...
- Wenzhou
- Кина
supplyautonomy.com/acmemachinerycompanypvt.in
Into Manufacturing of Paper Corrugated Carton Production Line, print finishing machines since last three decades with excellent customer base using range of our machine.
The state of art... Прочитај повеќе »
- Опрема за печатење и графички дизајн | Машини за пакување
- Mumbai
- Индија
supplyautonomy.com/siadgroupsrl.it
SIAD GROUP srl provides end to end solutions for the new business of printing. We provide services and products including consulting, workflow and finishing printing equipment to match the... Прочитај повеќе »
- Топла печат фолија | Опрема за печатење и графички дизајн
- Arese
- Италија
supplyautonomy.com/ishaninternational.in
we leading manufacturer of plastic printing machine and bag making machines viz., Rotogravure Printing Machine, Flexo Printing Machine, Bag making machine, side sealing machine, Slitting... Прочитај повеќе »
- Торба правење машини | Опрема за печатење и графички дизајн
- Ahmedabad
- Индија
supplyautonomy.com/junsheng.cn
Our company is located in Dongguang County, Hebei Province, China. We are specialized in manufacturing all kinds of water base ink printing slotting die-cutting machines and whole sets of carton... Прочитај повеќе »
- Опрема за чистење | Опрема за печатење и графички дизајн | Машини за пакување | Помошни опрема за пакување...
- Cangzhou
- Кина
supplyautonomy.com/zhejiangtianfengplasticmachineryplant.cn
Zhejiang Tianfeng Plastic Machinery Plant is a global supplier of standard and custom-engineered products and systems. Our products serve the complete range of PP/PE woven bag machine, leno mesh bag... Прочитај повеќе »
- Торба правење машини | Опрема за печатење и графички дизајн
- Wenzhou
- Кина
supplyautonomy.com/vishvaeximpvt.in
Manufacturer and Exporters of Roto Gravure Printing Machine, Flexo Graph Printing Machine, Laminators (Solvent less), Laminators (Base), Extrusion Machines, Small Packaging Machinery, Core Cutting... Прочитај повеќе »
- Шахти | Телекс опрема | Опрема за печатење и графички дизајн | Машини за пакување...
- Ahmedabad
- Индија
supplyautonomy.com/shanghaipripackmachineryco.cn
Shanghai Pripack Machinery Co., Ltd. is a company that specializes in providing printing & packaging machinery and production line. Owning experienced employees and cooperating with many... Прочитај повеќе »
- Алуминиумски легури | Опрема за печатење и графички дизајн | Машини за пакување...
- Shanghai
- Кина
supplyautonomy.com/bajajprintpackmachineriespvt.in
We supply hologram Machinery to produce holograms from hologram master shooting to die-cutting, includes hologram master shooting system (2D / 3D master and Dot-matrix master) , recombination... Прочитај повеќе »
- Други текстилни машини | Опрема за печатење и графички дизајн | Машини за пакување...
- New Delhi
- Индија
supplyautonomy.com/mmmauenhandelsgesellschaftmbh.de
MMM established in 1986 are specialists in matches industry.
Combination of integrity, high business ethics with sound consulatation, makes us your number one souce in Match Machinery and Material... Прочитај повеќе »
- Опрема за печатење и графички дизајн | Други користени машини | Тутун и производи за пушачи...
- Hamburg
- Германија
supplyautonomy.com/natrajcorrugatingmachinerycompany.in
India's leading manufacturer and exporter of paper corrugated board and box making machinery since1955,Brand SUPER NATARAJA FORMERLY KNOWN AS NATARAJA. company have the experience of making... Прочитај повеќе »
- Опрема за печатење и графички дизајн | Друг материјал опрема за ракување | Машини за пакување...
- New Delhi
- Индија
supplyautonomy.com/seniormachineryco.in
About Us
Promoted by a Team of qualified professionals. Highly experienced in the machinery filed.
We are 25 years old, out of which 15 years we were manufacturing Printing related... Прочитај повеќе »
- Опрема за печатење и графички дизајн | Хартија Машини за обработка на делови | Машини за пакување...
- Pune
- Индија
supplyautonomy.com/alphagraphics737.us
At Alphagraphics 737 Grapevine, TX we have the skills and tools to help brand your company effectively. Call us for printing services, blueprint, car wraps, signs and banners.
- Компјутерски работни станици за графички дизајнери | Опрема за печатење и графички дизајн | Копирање на планови - машини...
- Grapevine
- Соединети Американски Држави
supplyautonomy.com/webcoindustries.in
supplyautonomy.com/lapraco.in
For more than 38 years, Lapra Co. has been constantly demonstrating its innovative
power and is today one of the leading companies in the area of flexible packaging
Our passion for ... Прочитај повеќе »
- Опрема за печатење и графички дизајн | Rotogravure машина за печатење
- New Delhi
- Индија
supplyautonomy.com/multipresssrl.it
- Печат на пластика - машини | Шприцоване пластика - машини | Пластични материјали - машини за индустријата | Опрема за пе...
- Ponte San Marco
- Италија
supplyautonomy.com/urstechnologyofindia.in
Breaking new grounds in the domain of printers and allied machines, we, URS Technology Of India, have captured a huge market share. Our products are of high quality and meet the industrial quality... Прочитај повеќе »
- Опрема за печатење и графички дизајн | Печатење со мастило и боја суровина...
- Kolkata
- Индија
supplyautonomy.com/suntrading.in
supplyautonomy.com/kptechmachineindiapvt.in
- Ткива | Чанти | Паричници | Опрема за печатење и графички дизајн | Опрема за заварување | Не плетени ткаенини...
- Ahmedabad
- Индија
supplyautonomy.com/hicmachineryco.in
- Електронски прибор | Опрема за печатење и графички дизајн | Машини за пакување | Принтери и врзива...
- Amritsar
- Индија
supplyautonomy.com/chinacangzhoujiajiamachinerymanufacture.cn
- Градители "алатки | Моторно возило електрична и електронска опрема | Опрема за печатење и графички дизајн | Вретена...
- Cangzhou
- Кина
supplyautonomy.com/babrahindustrialcorporation.in
About Babrah Industrial CorporationWe, Babrah Industrial Corporation, are meeting the bulk and urgent orders of our valued clients via our robust production facilities, supported distribution network... Прочитај повеќе »
- Опрема за печатење и графички дизајн
- Amritsar
- Индија
supplyautonomy.com/carmelengineering.in
We are manufacturer, supplier and exporter of flexo printing machinery such as flexographic printing machine and apart from this we also deals into non woven printing machine, lamination machine,... Прочитај повеќе »
- Опрема за печатење и графички дизајн
- Madurai
- Индија
supplyautonomy.com/universalinksvarnishplimited.in
In the field of Inks & Varnish, we 'Universal Inks & Varnish (P) Ltd.' are leading the market since 1981 as a renowned manufacturer, exporter, importer and supplier. Our company has... Прочитај повеќе »
- Опрема за печатење и графички дизајн | Печатени материјали и сродни производи | Печатење со мастило и боја суровина...
- Delhi
- Индија
supplyautonomy.com/ramanindustries.in
In the year of 1971 the company was established and engaged itself as a paper converterand susequently in the year of 1973 it had started Machine manufacturing unit. Now-a-days it has covered area... Прочитај повеќе »
- Пластични ламиниране машини | Опрема за печатење и графички дизајн...
- Kolkata
- Индија
supplyautonomy.com/msenterprises20.in
To offer a comprehensive product line meeting the engineering needs of our clients, M.S. Enterprises was established in the year 1975. We are renowned in the industry as leading Manufacturer,... Прочитај повеќе »
- Опрема за печатење и графички дизајн
- Faridabad
- Индија
supplyautonomy.com/asindustrialconsultingservices.in
Catering a range of integrated technical consultancy services to a varied range of industrial houses for setting up new projects in India or abroad...A.S. Industrial Consulting Services, thereafter... Прочитај повеќе »
- Опрема за печатење и графички дизајн
- Gurgaon
- Индија
supplyautonomy.com/ruiancambridgemachinery.cn
Located in RUIAN, the well-known Soft Package City of China, Ruian CAMBRIDGE MACHINE I/E Company pours big energy in package machinery. In 2008, we got the foot in manufacturing of Plastic Film... Прочитај повеќе »
- Торба правење машини | Опрема за печатење и графички дизајн
- Ruian
- Кина
supplyautonomy.com/marsonsprintgrafmachinespvt.in
- Лепила и лента | Опрема за печатење и графички дизајн | Rotogravure машина за печатење | Машини за пакување | Печат фоли...
- Mumbai
- Индија