Loading...
Leitarniðurstöður fyrir: Sól vörur og tæki
Fundust 6324 fyrirtæki
supplyautonomy.com/hincoopower.ph
Hincoo Power offers comprehensive solutions that hugely augment the peak power shortage, given the development of the local economy, industry, and commerce. It has supported the rapid growth of the... Lesa meira »
- Rafmagn plöntur, sól | Sól virkjanir með ljósmynd rafmagns mótor frumur | Mát | Sól rekja spor einhvers fyrir photovo...
- Shenzhen
- Kína
supplyautonomy.com/placasar1es.es
supplyautonomy.com/guangdongnamkoopowerco.cn
supplyautonomy.com/apexenterprises.in
You will pleased to know that we professional in setup second hand Rolling mill,Induction or Arc furnace, Industrial Machinery and electrical items such as all type of motors(DC AC),Turbines,water... Lesa meira »
- Framkvæmdir | Einangrunarefni | Verkfæri fyrir bygginga | Ritföng | Veski | Dekkapsler, plast | Electric Motors | Ra...
- Secunderabad
- Indland
supplyautonomy.com/geospec.in
We are into business of providing turnkey solutions in Lighting Green Energy Solutions viz. Solar Wind energy solutions. We are operating in both Goverment as well as private sector have... Lesa meira »
- Rafmagns íhlutum | Glóperur | Lampar og leitarljós, asetýlen | Olía Lampar | Áfengi Lampar | Gas Lampar | Kerti Lampar |...
- Gurgaon
- Indland
supplyautonomy.com/indotechindustrialsolutionspvt.in
We are a diversified technology leader, providing integrated automation and software solutions to various industries like technology, power, service sector, mobile pstn line operators,... Lesa meira »
- Mjólkurduft | Fjarskipti - tæki og kerfi | Rafræn vistir | Rafmagns íhlutum | Rafbúnað og rafeindabúnað | Dísel rafala |...
- Pune
- Indland
supplyautonomy.com/yessolarsolutionscary.us
At Yes Solar Solutions, our unique advantage lies in our commitment to quality and the craftsmanship we bring to each project. We are the only NABCEP Accredited solar installer in North Carolina and... Lesa meira »
- Sól safnara, uppsetningu | Sól spjaldið þak-nær vinna | Sólarplötur | Sól spjaldið | Sól vörur og tæki
- Cary
- Bandaríkin
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Lesa meira »
- Öryggi vöru lyf | Flytja prentun | Innspýting mótun úr málmi | Einangrunarefni | Vor - eftir teikningu | Tengi | pípur |...
- Amravati
- Indland
supplyautonomy.com/laxmiindustries.in
Manufacturer and Exporters of Three Wheeler, Hand Operated Tricycles, Wheelchair, Walker, Crutches, Hearing Aids and Mopeds/Motor Cycles with Three Wheeler and Both Side Wheel Attachment System.
- Framleiðsla á áli | Verkfæri fyrir bygginga | Boltinn lokar | Butterfly lokar | Hveiti | Medical húsgögn | Textíl tengda...
- Indore
- Indland
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Lesa meira »
- Öryggi vöru lyf | Flytja prentun | Innspýting mótun úr málmi | Einangrunarefni | Vor - eftir teikningu | Tengi | pípur |...
- Mumbai
- Indland
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Lesa meira »
- Öryggi vöru lyf | Flytja prentun | Innspýting mótun úr málmi | Einangrunarefni | Vor - eftir teikningu | Tengi | pípur |...
- Faridabad
- Indland
supplyautonomy.com/china.cn
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade.
It has its offices at various places in India and has its global... Lesa meira »
- Framleiðsla á skrásetning vél | Textíl úrgangs vinnslu, ull | Textíl úrgangs vinnslu, hár | Textíl úrgangs vinnslu, bómu...
- Mumbai
- Indland
supplyautonomy.com/ronakgroup.in
Ronak Rocks Pvt. Ltd. is a professionally managed organization engaged in the production of a variety of stone products in various sizes and finishes. Our range of natural stone and natural building... Lesa meira »
- Heilsa verkefni | Fatnaður hönnun þjónustu | Ýmislegt bygginga | Rafmagns íhlutum | Rafhlaða pakkar | Áburður | Lækninga...
- Vadodara
- Indland
supplyautonomy.com/miplmanoharinternationalpvt.in
MIPL, one of the worlds most trusted brands, is a name with a long history that powers itself into new ventures. This trust extends to a series of products, services and solutions that cover diverse... Lesa meira »
- Boltinn lokar | Butterfly lokar | Plastvörur | Önnur efni umbúðir | Krampar, vír | Quartz steinn | Hnetur | Ryðfrítt stá...
- Ahmedabad
- Indland
supplyautonomy.com/babaenterprises.in
Baba Enterprises is a name to reckon with the spectrum of latest garment accessories. The business avenues of our company comprises of manufacturing, supplying and exporting a wide range of apparel... Lesa meira »
- Framkvæmdir | Verkfæri fyrir bygginga | Húsgögnum | Þjóð klæði | Dúkur | Fat hnoð | Rafmagns íhlutum | Vel boranir véla ...
- New Delhi
- Indland
supplyautonomy.com/basantproductsindia.in
INTRODUCTION
M / S Basant Products (India) is a prestigious award winner for quality Marketing and three BIS licenses holder, manufacturer and Exporter of Diesel Generating Sets, Diesel Engines,... Lesa meira »
- Önnur þjónusta umboðsskrifstofa | Dísel rafala | Electric Motors | Framleiðsla álversins og búnað fyrir matvælaiðnað, ót...
- Agra
- Indland
supplyautonomy.com/citadelarchitecturalsolutionspvt.in
Citadel Architectural Solutions Pvt. Ltd., is an innovative company headquartered in Mumbai. Citadel works with a number of innovative roofing and cladding products and solutions, as well as... Lesa meira »
- Loft purifiers | Þak | Skreytt hár-þrýstingur lagskipt / HPL | Plastvörur | Plast filma | Rafræn merki | Sól vörur og tæ...
- Mumbai
- Indland
supplyautonomy.com/scientechtechnologiespvt.in
Scientech Technologies Pvt. Ltd. is an ISO 9001:2008 certified company that has a strong presence in educational, health care, environmental and industrial sectors. With more than 550 diverse... Lesa meira »
- Rafbúnað og rafeindabúnað | Aðrar birgðir máttur | Iðnaðar aflgjafa | Vel boranir véla | Rafmagns-og rafeindabúnaði | Læ...
- Indore
- Indland
supplyautonomy.com/spaceagesecuritysystems.in
Spaceage Security Systems Ltd. is an exporter of India Solar Lamps products. With a well management system, Sisale strives to offer the best quality products and service as possible as we can, as... Lesa meira »
- Síma setur | Fjarskipti - tæki og kerfi | Rafeindabúnaður | Rafræn vistir | Rafmagns íhlutum | Bíll viðvörun | Tími uppt...
- Delhi
- Indland
supplyautonomy.com/uniquecombustion.in
Company Brief Empowered with technological expertise and service support of a highly skilled workforce, we, Unique Combustion, have emerged as one of the leading manufacturers, exporters, importers,... Lesa meira »
- Viðskipti ferðast pakka | Katla hlutum | Brennara, iðnaðar | Electric Motors | Rafmagns-og rafeindabúnaði | Sól vörur og...
- New Delhi
- Indland
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Lesa meira »
- Öryggi vöru lyf | Flytja prentun | Innspýting mótun úr málmi | Einangrunarefni | Vor - eftir teikningu | Tengi | pípur |...
- Ahmedabad
- Indland
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Lesa meira »
- Öryggi vöru lyf | Flytja prentun | Innspýting mótun úr málmi | Einangrunarefni | Vor - eftir teikningu | Tengi | pípur |...
- Bardoli
- Indland
supplyautonomy.com/jayagenciez.in
Jay Agenciez is an authorized agent in India for some of the worlds most famous Brands of Industrial Products. We are mainly into the Import and Export supplies of Industrial Consumables which are... Lesa meira »
- Einangrunarefni | Hreinsun búnaðar | Plastvörur | Lím og borði | Suðu búnaður | Krampar, vír | Sól vörur og tæki...
- Surat
- Indland
supplyautonomy.com/trademaxenterprise.in
TradeMax Enterprise has been founded by a team of professionals with rich experience in international business and Trading. Our team has worked for years in sourcing of products and... Lesa meira »
- Teppi | Cable pökkun kassa, raf | Electric Motors | Pökkun vélar | Fatnaður | Coir vörur | Gúmmí og gúmmí vörum | Sól vö...
- Mumbai
- Indland
supplyautonomy.com/ganpatielectricalspvt.in
Profile
Established in the year 1998, Ganpati Electricals Pvt. Ltd. is amongst the leading manufacturers and traders of wide range of electrical equipment. We specialize in Servo Voltage... Lesa meira »
- Raforkuframleiðslu og dreifingu iðnaður | Önnur þjónusta hönnun | Terminal blokkir | Dísel rafala | Rafmagns-og rafeind...
- Delhi
- Indland
supplyautonomy.com/srisaienterprises.in
EXPORT PACKERS in Gujarat
QUALITY PACKERS/vinyl packers/anti corrosive packaging
DISTRIBUTOR OF Valvoline Cummins ltd. Tectyl products.
Industrial lubricants distributors
Polka dotted hand... Lesa meira »
- Raforkuframleiðslu og dreifingu iðnaður | Hraðboði þjónusta | Boltinn lokar | Butterfly lokar | Sekkir og pokar | Töskur...
- Warangal
- Indland
supplyautonomy.com/crystalhomeappliancesindia.in
Ask it and you have it with CRYSTAL HOME APPLIANCES (INDIA) presenting a wide range of MLM products with guaranteed best price. We are one of the biggest names engaged in the domain of offering ... Lesa meira »
- Custom hugbúnaðarþróun þjónusta | Hreinsun búnaðar | Óáfengir drykkir | Dúkur | Veski | Rafbúnað og rafeindabúnað | Korn...
- Jaipur
- Indland
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... Lesa meira »
- Sólarorku framleiðslu | Sól ráðgjafar orku | Lithium rafgeymar | Sól vörur og tæki | Sólarorku búnað, framleiðen...
- Gurgaon
- Indland
supplyautonomy.com/zenithfilms.sg
At Zenith Window Films, we offer a spectrum of of 3m solar window films, 3m whiteboard films for home and window tinting in Singapore at cheap prices. We are dedicated to offer excellent service to... Lesa meira »
- Sól vörur og tæki
- singapore
- Singapúr