Resultats de la cerca per a: Productes i equips d'energia solar

Empreses 6323 trobats


supplyautonomy.com/hincoopower.ph
Hincoo Power offers comprehensive solutions that hugely augment the peak power shortage, given the development of the local economy, industry, and commerce. It has supported the rapid growth of the... Llegir més »
  • Centrals elèctriques, energia solar | Planta d'energia solar, cèl · lula fotovoltaica | Mòduls | Els seguidors solars de...
  • Shenzhen
  • Xina
supplyautonomy.com/placasar1es.es
  • Serveis de cablejat per a la indústria elèctrica | Aïllament tèrmic per a panells solars | Bateries d'emmagatzematge d'e...
  • Madrid
  • Espanya
supplyautonomy.com/geospec.in
We are into business of providing turnkey solutions in Lighting Green Energy Solutions viz. Solar Wind energy solutions. We are operating in both Goverment as well as private sector have... Llegir més »
  • Els components elèctrics | Els llums incandescents | Els llums i focus, acetilè | Llums, oli | Llums Spirit | Llums de g...
  • Gurgaon
  • Índia
supplyautonomy.com/apexenterprises.in
You will pleased to know that we professional in setup second hand Rolling mill,Induction or Arc furnace, Industrial Machinery and electrical items such as all type of motors(DC AC),Turbines,water... Llegir més »
  • Els projectes de construcció | Els materials d'aïllament | Eines Builders | Papereria | Moneders | Càpsules de taponat i...
  • Secunderabad
  • Índia
supplyautonomy.com/indotechindustrialsolutionspvt.in
We are a diversified technology leader, providing integrated automation and software solutions to various industries like technology, power, service sector, mobile pstn line operators,... Llegir més »
  • La llet en pols | Telecomunicacions - equips i sistemes | Material electrònic | Els components elèctrics | Els p...
  • Pune
  • Índia
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Llegir més »
  • Els agents de seguretat de productes | Impressió de transferència | Serveis d'emmotllament per injecció, metall | Els ma...
  • Amravati
  • Índia
supplyautonomy.com/laxmiindustries.in
Manufacturer and Exporters of Three Wheeler, Hand Operated Tricycles, Wheelchair, Walker, Crutches, Hearing Aids and Mopeds/Motor Cycles with Three Wheeler and Both Side Wheel Attachment System.
  • Fabricants d'alumini | Eines Builders | Les vàlvules de bola | Vàlvules de papallona | Blat | Mobles metges | Productes ...
  • Indore
  • Índia
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Llegir més »
  • Els agents de seguretat de productes | Impressió de transferència | Serveis d'emmotllament per injecció, metall | Els ma...
  • Mumbai
  • Índia
supplyautonomy.com/yessolarsolutionscary.us
At Yes Solar Solutions, our unique advantage lies in our commitment to quality and the craftsmanship we bring to each project. We are the only NABCEP Accredited solar installer in North Carolina and... Llegir més »
  • Instal · lació de panells d'energia solar | Panell de Treballs de recobriment Solar | Els panells solars | Panell solar ...
  • Cary
  • Estats Units
supplyautonomy.com/basantproductsindia.in
INTRODUCTION M / S Basant Products (India) is a prestigious award winner for quality Marketing and three BIS licenses holder, manufacturer and Exporter of Diesel Generating Sets, Diesel Engines,... Llegir més »
  • Altres serveis d'agència | Generadors de dièsel | Motor elèctric | Planta de la indústria alimentària i cions equip | Mà...
  • Agra
  • Índia
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Llegir més »
  • Els agents de seguretat de productes | Impressió de transferència | Serveis d'emmotllament per injecció, metall | Els ma...
  • Faridabad
  • Índia
supplyautonomy.com/miplmanoharinternationalpvt.in
MIPL, one of the worlds most trusted brands, is a name with a long history that powers itself into new ventures. This trust extends to a series of products, services and solutions that cover diverse... Llegir més »
  • Les vàlvules de bola | Vàlvules de papallona | Productes de plàstic | Altres materials d'envasat | Grapes, filferro | Pe...
  • Ahmedabad
  • Índia
supplyautonomy.com/citadelarchitecturalsolutionspvt.in
Citadel Architectural Solutions Pvt. Ltd., is an innovative company headquartered in Mumbai. Citadel works with a number of innovative roofing and cladding products and solutions, as well as... Llegir més »
  • Purificadors d'aire | Sostre | Decoratiu laminats d'alta pressió / HPL | Productes de plàstic | Pel · lícula de plàstic ...
  • Mumbai
  • Índia
supplyautonomy.com/babaenterprises.in
Baba Enterprises is a name to reckon with the spectrum of latest garment accessories. The business avenues of our company comprises of manufacturing, supplying and exporting a wide range of apparel... Llegir més »
  • Els projectes de construcció | Eines Builders | Mobiliari | Roba ètnica | Teixits | Reblons roba | Els components e...
  • New Delhi
  • Índia
supplyautonomy.com/ronakgroup.in
Ronak Rocks Pvt. Ltd. is a professionally managed organization engaged in the production of a variety of stone products in various sizes and finishes. Our range of natural stone and natural building... Llegir més »
  • Els projectes de salut | Serveis de disseny de peces de vestir | Diverses pedres de construcció | Els components ...
  • Vadodara
  • Índia
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade. It has its offices at various places in India and has its global... Llegir més »
  • Serveis de processament de la màquina de remolc | Els serveis de tractament de residus tèxtils, llana | Els serveis de t...
  • Mumbai
  • Índia
supplyautonomy.com/china.cn
Self-aligning ball bearings, ball bearings, spherical roller bearings, roller bearings, angular contact ball bearings, ball bearings, cylindrical.
  • Serveis d'emmotllament per injecció, metall | Tubs i canonades d'acer | Equips de Neteja | Eines Builders | Mobles de ...
  • Hangzhou
  • Xina
supplyautonomy.com/jayagenciez.in
Jay Agenciez is an authorized agent in India for some of the worlds most famous Brands of Industrial Products. We are mainly into the Import and Export supplies of Industrial Consumables which are... Llegir més »
  • Els materials d'aïllament | Equips de Neteja | Productes de plàstic | Adhesius i cintes | Equip de soldadura | Grapes, f...
  • Surat
  • Índia
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Llegir més »
  • Els agents de seguretat de productes | Impressió de transferència | Serveis d'emmotllament per injecció, metall | Els ma...
  • Ahmedabad
  • Índia
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Llegir més »
  • Els agents de seguretat de productes | Impressió de transferència | Serveis d'emmotllament per injecció, metall | Els ma...
  • Bardoli
  • Índia
supplyautonomy.com/scientechtechnologiespvt.in
Scientech Technologies Pvt. Ltd. is an ISO 9001:2008 certified company that has a strong presence in educational, health care, environmental and industrial sectors. With more than 550 diverse... Llegir més »
  • Els productes elèctrics i electrònics | Altres fonts d'alimentació | Font d'alimentació industrial | Màquines de perf...
  • Indore
  • Índia
supplyautonomy.com/spaceagesecuritysystems.in
Spaceage Security Systems Ltd. is an exporter of India Solar Lamps products. With a well management system, Sisale strives to offer the best quality products and service as possible as we can, as... Llegir més »
  • Aparells telefònics | Telecomunicacions - equips i sistemes | Els components electrònics | Material electrònic | Els co...
  • Delhi
  • Índia
supplyautonomy.com/uniquecombustion.in
Company Brief Empowered with technological expertise and service support of a highly skilled workforce, we, Unique Combustion, have emerged as one of the leading manufacturers, exporters, importers,... Llegir més »
  • Paquets de viatge de negocis | Parts de la caldera | Cremadors industrials | Motor elèctric | Equips elèctrics i e...
  • New Delhi
  • Índia
supplyautonomy.com/trademaxenterprise.in
TradeMax Enterprise has been founded by a team of professionals with rich experience in international business and Trading. Our team has worked for years in sourcing of products and... Llegir més »
  • Catifes | Premsaestopes | Motor elèctric | Maquinària d'embalatge | Roba | Productes de fibra de coco | Articles de g...
  • Mumbai
  • Índia
supplyautonomy.com/ganpatielectricalspvt.in
Profile Established in the year 1998, Ganpati Electricals Pvt. Ltd. is amongst the leading manufacturers and traders of wide range of electrical equipment. We specialize in Servo Voltage... Llegir més »
  • Contractistes a la producció d'electricitat i la indústria de la distribució | Altres serveis de disseny | Els blocs de ...
  • Delhi
  • Índia
supplyautonomy.com/crystalhomeappliancesindia.in
Ask it and you have it with CRYSTAL HOME APPLIANCES (INDIA) presenting a wide range of MLM products with guaranteed best price.  We are one of the biggest names engaged in the domain of offering ... Llegir més »
  • Serveis de desenvolupament de programari personalitzat | Equips de Neteja | Begudes no alcohòliques | Teixits | ...
  • Jaipur
  • Índia
supplyautonomy.com/acmeinternational1.in
Established in 2003. Acme international is an exporters of machinery equipments for jewellery industries. We always strive to bring the latest and the best, keeping pace with Technology, time and... Llegir més »
  • Cortines d'aire | Productes de plàstic | Els productes elèctrics i electrònics | Forns per a joieria | Laminadors per a ...
  • Mumbai
  • Índia
supplyautonomy.com/srisaienterprises.in
EXPORT PACKERS in Gujarat QUALITY PACKERS/vinyl packers/anti corrosive packaging DISTRIBUTOR OF Valvoline Cummins ltd. Tectyl products. Industrial lubricants distributors Polka dotted hand... Llegir més »
  • Contractistes a la producció d'electricitat i la indústria de la distribució | Els serveis de missatgeria | Les và...
  • Warangal
  • Índia
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... Llegir més »
  • La producció d'energia solar | Consultors d'energia solar | Acumuladors de liti | Productes i equips d'energia solar | ...
  • Gurgaon
  • Índia
supplyautonomy.com/zenithfilms.sg
At Zenith Window Films, we offer a spectrum of of 3m solar window films, 3m whiteboard films for home and window tinting in Singapore at cheap prices. We are dedicated to offer excellent service to... Llegir més »
  • Productes i equips d'energia solar
  • singapore
  • Singapur