Hakutulokset: Solar tuotteet ja tarvikkeet
Löytyi 6323 yrityksiäsupplyautonomy.com/hincoopower.ph
Hincoo Power offers comprehensive solutions that hugely augment the peak power shortage, given the development of the local economy, industry, and commerce. It has supported the rapid growth of the... Lue lisää »
- Voimalat / voimalaitokset, aurinko- / aurinkovoimalat | Aurinkovoimalaitokset, valosähkökenno- | Moduulit | S...
- Shenzhen
- Kiina
supplyautonomy.com/placasar1es.es
supplyautonomy.com/geospec.in
We are into business of providing turnkey solutions in Lighting Green Energy Solutions viz. Solar Wind energy solutions. We are operating in both Goverment as well as private sector have... Lue lisää »
- Sähkökomponentit | Hehkulamput | Lamput ja valonheittimet, asetyleeni- | Lamput, öljy- | Lamput, spriikäyttöiset | Lamp...
- Gurgaon
- Intia
supplyautonomy.com/apexenterprises.in
You will pleased to know that we professional in setup second hand Rolling mill,Induction or Arc furnace, Industrial Machinery and electrical items such as all type of motors(DC AC),Turbines,water... Lue lisää »
- Rakennushankkeet | Eristeet | Rakennustyökalut | Kirjoitustarvikkeet | Lompakot | Kapselit ja päällyskapselit, muovia | ...
- Secunderabad
- Intia
supplyautonomy.com/indotechindustrialsolutionspvt.in
We are a diversified technology leader, providing integrated automation and software solutions to various industries like technology, power, service sector, mobile pstn line operators,... Lue lisää »
- Maitojauhe | Televiestintä - laitteet ja järjestelmät | Elektroniikkatarvikkeet | Sähkökomponentit | Sähkö- ja elektr...
- Pune
- Intia
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Lue lisää »
- Turvallisuus tuote aineet | Siirto tulostus | Ruiskuvalumuovauspalvelut metallille | Eristeet | Mittatilausjouset |...
- Amravati
- Intia
supplyautonomy.com/laxmiindustries.in
Manufacturer and Exporters of Three Wheeler, Hand Operated Tricycles, Wheelchair, Walker, Crutches, Hearing Aids and Mopeds/Motor Cycles with Three Wheeler and Both Side Wheel Attachment System.
- Valmistajat, rakenteet alumiinista | Rakennustyökalut | Palloventtiilit | Läppäventtiilit | Vehnä | Terveydenhuollon kal...
- Indore
- Intia
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Lue lisää »
- Turvallisuus tuote aineet | Siirto tulostus | Ruiskuvalumuovauspalvelut metallille | Eristeet | Mittatilausjouset |...
- Mumbai
- Intia
supplyautonomy.com/yessolarsolutionscary.us
At Yes Solar Solutions, our unique advantage lies in our commitment to quality and the craftsmanship we bring to each project. We are the only NABCEP Accredited solar installer in North Carolina and... Lue lisää »
- Asennustyöt, aurinkopaneelit | Aurinkopaneelien kattoasennustyöt | Paneelit, aurinko- / aurinkopaneelit / aurinkokennot ...
- Cary
- Yhdysvallat
supplyautonomy.com/basantproductsindia.in
INTRODUCTION
M / S Basant Products (India) is a prestigious award winner for quality Marketing and three BIS licenses holder, manufacturer and Exporter of Diesel Generating Sets, Diesel Engines,... Lue lisää »
- Muut viraston palvelut | Diesel generaattorit | Sähkömoottorit | Elintarviketeollisuuden koneet ja laitteet, yleisesti |...
- Agra
- Intia
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Lue lisää »
- Turvallisuus tuote aineet | Siirto tulostus | Ruiskuvalumuovauspalvelut metallille | Eristeet | Mittatilausjouset |...
- Faridabad
- Intia
supplyautonomy.com/miplmanoharinternationalpvt.in
MIPL, one of the worlds most trusted brands, is a name with a long history that powers itself into new ventures. This trust extends to a series of products, services and solutions that cover diverse... Lue lisää »
- Palloventtiilit | Läppäventtiilit | Muovituotteet | Muut pakkausmateriaalit | Niitit, metallia | Kvartsikivi | Pähkinät ...
- Ahmedabad
- Intia
supplyautonomy.com/citadelarchitecturalsolutionspvt.in
Citadel Architectural Solutions Pvt. Ltd., is an innovative company headquartered in Mumbai. Citadel works with a number of innovative roofing and cladding products and solutions, as well as... Lue lisää »
- Ilmanpuhdistimet | Katot | Decorative korkea paine laminaatit / HPL | Muovituotteet | Muovifilmi | Elektroniset merkit...
- Mumbai
- Intia
supplyautonomy.com/babaenterprises.in
Baba Enterprises is a name to reckon with the spectrum of latest garment accessories. The business avenues of our company comprises of manufacturing, supplying and exporting a wide range of apparel... Lue lisää »
- Rakennushankkeet | Rakennustyökalut | Sisustaminen | Etniset vaatteet | Kankaat | Vaatteiden niitit | Sähkökomponentit |...
- New Delhi
- Intia
supplyautonomy.com/ronakgroup.in
Ronak Rocks Pvt. Ltd. is a professionally managed organization engaged in the production of a variety of stone products in various sizes and finishes. Our range of natural stone and natural building... Lue lisää »
- Terveys hankkeet | Vaatteet suunnittelupalvelut | Erilaiset rakennuskivet | Sähkökomponentit | Paristopakkaukset | L...
- Vadodara
- Intia
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade.
It has its offices at various places in India and has its global... Lue lisää »
- Jalostuspalvelut konerohtimille | Jalostuspalvelut villatekstiilijätteelle | Jalostuspalvelut karvatekstiilijätteelle | ...
- Mumbai
- Intia
supplyautonomy.com/china.cn
supplyautonomy.com/jayagenciez.in
Jay Agenciez is an authorized agent in India for some of the worlds most famous Brands of Industrial Products. We are mainly into the Import and Export supplies of Industrial Consumables which are... Lue lisää »
- Eristeet | Siivousvälineet | Muovituotteet | Liimat ja teipit | Hitsauslaitteet | Niitit, metallia | Solar tuotteet ja ...
- Surat
- Intia
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Lue lisää »
- Turvallisuus tuote aineet | Siirto tulostus | Ruiskuvalumuovauspalvelut metallille | Eristeet | Mittatilausjouset |...
- Ahmedabad
- Intia
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Lue lisää »
- Turvallisuus tuote aineet | Siirto tulostus | Ruiskuvalumuovauspalvelut metallille | Eristeet | Mittatilausjouset |...
- Bardoli
- Intia
supplyautonomy.com/scientechtechnologiespvt.in
Scientech Technologies Pvt. Ltd. is an ISO 9001:2008 certified company that has a strong presence in educational, health care, environmental and industrial sectors. With more than 550 diverse... Lue lisää »
- Sähkö- ja elektroniikkatuotteet | Muut virtalähteet | Virtalähde | Öljyn- tai kaasunporauskoneet | Sähköiset ja elektr...
- Indore
- Intia
supplyautonomy.com/spaceagesecuritysystems.in
Spaceage Security Systems Ltd. is an exporter of India Solar Lamps products. With a well management system, Sisale strives to offer the best quality products and service as possible as we can, as... Lue lisää »
- Puhelinkoneet | Televiestintä - laitteet ja järjestelmät | Elektroniset komponentit | Elektroniikkatarvikkeet | Sä...
- Delhi
- Intia
supplyautonomy.com/uniquecombustion.in
Company Brief Empowered with technological expertise and service support of a highly skilled workforce, we, Unique Combustion, have emerged as one of the leading manufacturers, exporters, importers,... Lue lisää »
- Business Travel paketit | Kattilan osat | Polttimet, teollisuus- | Sähkömoottorit | Sähköiset ja elektroniset välineet |...
- New Delhi
- Intia
supplyautonomy.com/trademaxenterprise.in
TradeMax Enterprise has been founded by a team of professionals with rich experience in international business and Trading. Our team has worked for years in sourcing of products and... Lue lisää »
- Matot | Tiivistysrenkaat kaapeleihin | Sähkömoottorit | Pakkauskoneet | Asut | Kookos tuotteet | Kumi-ja kumi | Solar t...
- Mumbai
- Intia
supplyautonomy.com/ganpatielectricalspvt.in
Profile
Established in the year 1998, Ganpati Electricals Pvt. Ltd. is amongst the leading manufacturers and traders of wide range of electrical equipment. We specialize in Servo Voltage... Lue lisää »
- Asennustyöt, sähkö- / sähköasennustyöt, sähköntuotannolle ja sähkönjakelulle, urakointi | Muut suunnittelupalvelut | Riv...
- Delhi
- Intia
supplyautonomy.com/crystalhomeappliancesindia.in
Ask it and you have it with CRYSTAL HOME APPLIANCES (INDIA) presenting a wide range of MLM products with guaranteed best price. We are one of the biggest names engaged in the domain of offering ... Lue lisää »
- Asiakaskohtaisten ohjelmistojen kehittämispalvelut | Siivousvälineet | Alkoholittomat juomat | Kankaat | Lompakot | S...
- Jaipur
- Intia
supplyautonomy.com/acmeinternational1.in
Established in 2003. Acme international is an exporters of machinery equipments for jewellery industries. We always strive to bring the latest and the best, keeping pace with
Technology, time and... Lue lisää »
- Ilmaverhot | Muovituotteet | Sähkö- ja elektroniikkatuotteet | Uunit koru- ja kultasepille | Valssauslaitokset k...
- Mumbai
- Intia
supplyautonomy.com/srisaienterprises.in
EXPORT PACKERS in Gujarat
QUALITY PACKERS/vinyl packers/anti corrosive packaging
DISTRIBUTOR OF Valvoline Cummins ltd. Tectyl products.
Industrial lubricants distributors
Polka dotted hand... Lue lisää »
- Asennustyöt, sähkö- / sähköasennustyöt, sähköntuotannolle ja sähkönjakelulle, urakointi | Pikalähettipalvelut | Palloven...
- Warangal
- Intia
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... Lue lisää »
- Aurinkoenergian tuotanto | Konsultit, aurinkoenergia | Litiumakut | Solar tuotteet ja tarvikkeet |...
- Gurgaon
- Intia
supplyautonomy.com/zenithfilms.sg
At Zenith Window Films, we offer a spectrum of of 3m solar window films, 3m whiteboard films for home and window tinting in Singapore at cheap prices. We are dedicated to offer excellent service to... Lue lisää »
- Solar tuotteet ja tarvikkeet
- singapore
- Singapore