के लिए खोज परिणाम: सौर उत्पादों और उपकरणों
मिली 6323 कंपनियांsupplyautonomy.com/hincoopower.ph
Hincoo Power offers comprehensive solutions that hugely augment the peak power shortage, given the development of the local economy, industry, and commerce. It has supported the rapid growth of the... और पढ़ें »
- पावर स्टेशन, सौर ऊर्जा | सौर ऊर्जा संयंत्र, फोटोवोल्टिक सेल | मॉड्यूल | फोटोवोल्टिक पैनलों के लिए सौर ट्रैकर | सौर पैनलो...
- Shenzhen
- चीन
supplyautonomy.com/placasar1es.es
supplyautonomy.com/geospec.in
We are into business of providing turnkey solutions in Lighting Green Energy Solutions viz. Solar Wind energy solutions. We are operating in both Goverment as well as private sector have... और पढ़ें »
- विद्युत उपकरणों | गरमागरम लैंप | लैंप और दूधिया रोशनी, एसिटिलीन | दीपक, तेल | आत्मा लैंप | गैस लैंप | मोमबत्ती लैंप | कै...
- Gurgaon
- भारत
supplyautonomy.com/apexenterprises.in
You will pleased to know that we professional in setup second hand Rolling mill,Induction or Arc furnace, Industrial Machinery and electrical items such as all type of motors(DC AC),Turbines,water... और पढ़ें »
- निर्माण परियोजनाओं | इन्सुलेशन सामग्री | बिल्डर्स 'उपकरण | लेखन - सामग्री | जेब | कैपिंग और overcapping कैप्सूल, प्लास्ट...
- Secunderabad
- भारत
supplyautonomy.com/indotechindustrialsolutionspvt.in
We are a diversified technology leader, providing integrated automation and software solutions to various industries like technology, power, service sector, mobile pstn line operators,... और पढ़ें »
- मिल्क पाउडर | दूरसंचार - उपकरणों और प्रणालियों | इलेक्ट्रॉनिक आपूर्ति | विद्युत उपकरणों | इलेक्ट्रिकल और इलेक्ट्रॉनिक उत...
- Pune
- भारत
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... और पढ़ें »
- सुरक्षा उत्पाद एजेंटों | अंतरण मुद्रण | इंजेक्शन मोल्डिंग सेवाओं, धातु | इन्सुलेशन सामग्री | कस्टम डिजाइन स्प्रिंग्स | क...
- Amravati
- भारत
supplyautonomy.com/laxmiindustries.in
Manufacturer and Exporters of Three Wheeler, Hand Operated Tricycles, Wheelchair, Walker, Crutches, Hearing Aids and Mopeds/Motor Cycles with Three Wheeler and Both Side Wheel Attachment System.
- Fabricators, एल्यूमीनियम | बिल्डर्स 'उपकरण | गेंद वाल्व | तितली वाल्व | गेहूँ | मेडिकल फर्नीचर | वस्त्र उत्पादों से संबं...
- Indore
- भारत
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... और पढ़ें »
- सुरक्षा उत्पाद एजेंटों | अंतरण मुद्रण | इंजेक्शन मोल्डिंग सेवाओं, धातु | इन्सुलेशन सामग्री | कस्टम डिजाइन स्प्रिंग्स | क...
- Mumbai
- भारत
supplyautonomy.com/yessolarsolutionscary.us
At Yes Solar Solutions, our unique advantage lies in our commitment to quality and the craftsmanship we bring to each project. We are the only NABCEP Accredited solar installer in North Carolina and... और पढ़ें »
- सौर ऊर्जा पैनल स्थापना | सौर पैनल छत को कवर करने का काम | सौर पैनलों | सौर पैनल | सौर उत्पादों और उपकरणों...
- Cary
- संयुक्त राज्य अमेरिका
supplyautonomy.com/basantproductsindia.in
INTRODUCTION
M / S Basant Products (India) is a prestigious award winner for quality Marketing and three BIS licenses holder, manufacturer and Exporter of Diesel Generating Sets, Diesel Engines,... और पढ़ें »
- अन्य एजेंसी सेवाओं | डीजल जनरेटर | इलेक्ट्रिक मोटर | खाद्य उद्योग संयंत्र और उपकरण nes | खैर ड्रिलिंग मशीनरी | वेल्डिंग ...
- Agra
- भारत
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... और पढ़ें »
- सुरक्षा उत्पाद एजेंटों | अंतरण मुद्रण | इंजेक्शन मोल्डिंग सेवाओं, धातु | इन्सुलेशन सामग्री | कस्टम डिजाइन स्प्रिंग्स | क...
- Faridabad
- भारत
supplyautonomy.com/miplmanoharinternationalpvt.in
MIPL, one of the worlds most trusted brands, is a name with a long history that powers itself into new ventures. This trust extends to a series of products, services and solutions that cover diverse... और पढ़ें »
- गेंद वाल्व | तितली वाल्व | प्लास्टिक उत्पादों | अन्य पैकेजिंग सामग्री | स्टेपल्स, तार | क्वार्ट्ज पत्थर | पागल | स्टेनले...
- Ahmedabad
- भारत
supplyautonomy.com/citadelarchitecturalsolutionspvt.in
Citadel Architectural Solutions Pvt. Ltd., is an innovative company headquartered in Mumbai. Citadel works with a number of innovative roofing and cladding products and solutions, as well as... और पढ़ें »
- हवा | छत | सजावटी उच्च दबाव / एचपीएल laminates | प्लास्टिक उत्पादों | प्लास्टिक की फिल्म | इलेक्ट्रॉनिक संकेत | सौर उत्प...
- Mumbai
- भारत
supplyautonomy.com/babaenterprises.in
Baba Enterprises is a name to reckon with the spectrum of latest garment accessories. The business avenues of our company comprises of manufacturing, supplying and exporting a wide range of apparel... और पढ़ें »
- निर्माण परियोजनाओं | बिल्डर्स 'उपकरण | प्रस्तुत | जातीय वस्त्र | कपड़े | परिधान rivets | विद्युत उपकरणों | खैर ड्रिलिंग ...
- New Delhi
- भारत
supplyautonomy.com/ronakgroup.in
Ronak Rocks Pvt. Ltd. is a professionally managed organization engaged in the production of a variety of stone products in various sizes and finishes. Our range of natural stone and natural building... और पढ़ें »
- स्वास्थ्य परियोजनाओं | परिधान डिजाइन सेवाओं | विविध इमारत पत्थर | विद्युत उपकरणों | बैटरी पैक | उर्वरक | औषधि लेख | बॉडी...
- Vadodara
- भारत
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade.
It has its offices at various places in India and has its global... और पढ़ें »
- मशीन टो प्रसंस्करण सेवाएं | वस्त्र कचरे प्रसंस्करण सेवाएं, ऊन | वस्त्र कचरे प्रसंस्करण सेवाएं, बाल | वस्त्र कचरे प्रसंस्...
- Mumbai
- भारत
supplyautonomy.com/china.cn
supplyautonomy.com/jayagenciez.in
Jay Agenciez is an authorized agent in India for some of the worlds most famous Brands of Industrial Products. We are mainly into the Import and Export supplies of Industrial Consumables which are... और पढ़ें »
- इन्सुलेशन सामग्री | उपकरण सफाई | प्लास्टिक उत्पादों | चिपकने वाले और टेप | वेल्डिंग उपकरण | स्टेपल्स, तार | सौर उत्पादों...
- Surat
- भारत
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... और पढ़ें »
- सुरक्षा उत्पाद एजेंटों | अंतरण मुद्रण | इंजेक्शन मोल्डिंग सेवाओं, धातु | इन्सुलेशन सामग्री | कस्टम डिजाइन स्प्रिंग्स | क...
- Ahmedabad
- भारत
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... और पढ़ें »
- सुरक्षा उत्पाद एजेंटों | अंतरण मुद्रण | इंजेक्शन मोल्डिंग सेवाओं, धातु | इन्सुलेशन सामग्री | कस्टम डिजाइन स्प्रिंग्स | क...
- Bardoli
- भारत
supplyautonomy.com/scientechtechnologiespvt.in
Scientech Technologies Pvt. Ltd. is an ISO 9001:2008 certified company that has a strong presence in educational, health care, environmental and industrial sectors. With more than 550 diverse... और पढ़ें »
- इलेक्ट्रिकल और इलेक्ट्रॉनिक उत्पादों | अन्य बिजली की आपूर्ति | औद्योगिक बिजली की आपूर्ति | खैर ड्रिलिंग मशीनरी | इलेक्ट्...
- Indore
- भारत
supplyautonomy.com/spaceagesecuritysystems.in
Spaceage Security Systems Ltd. is an exporter of India Solar Lamps products. With a well management system, Sisale strives to offer the best quality products and service as possible as we can, as... और पढ़ें »
- टेलीफोन सेट | दूरसंचार - उपकरणों और प्रणालियों | इलेक्ट्रॉनिक उपकरणों | इलेक्ट्रॉनिक आपूर्ति | विद्युत उपकरणों | कार अला...
- Delhi
- भारत
supplyautonomy.com/uniquecombustion.in
Company Brief Empowered with technological expertise and service support of a highly skilled workforce, we, Unique Combustion, have emerged as one of the leading manufacturers, exporters, importers,... और पढ़ें »
- व्यापार यात्रा संकुल | बॉयलर भागों | बर्नर, औद्योगिक | इलेक्ट्रिक मोटर | इलेक्ट्रिकल और इलेक्ट्रॉनिक उपकरणों | सौर उत्पा...
- New Delhi
- भारत
supplyautonomy.com/trademaxenterprise.in
TradeMax Enterprise has been founded by a team of professionals with rich experience in international business and Trading. Our team has worked for years in sourcing of products and... और पढ़ें »
- कालीन | केबल ग्रंथियों | इलेक्ट्रिक मोटर | पैकेजिंग मशीनरी | वस्त्र | कॉयर उत्पादों | रबर और रबर उत्पादों | सौर उत्पादों...
- Mumbai
- भारत
supplyautonomy.com/ganpatielectricalspvt.in
Profile
Established in the year 1998, Ganpati Electricals Pvt. Ltd. is amongst the leading manufacturers and traders of wide range of electrical equipment. We specialize in Servo Voltage... और पढ़ें »
- बिजली उत्पादन और वितरण उद्योग के लिए ठेकेदार | अन्य डिजाइन सेवाओं | टर्मिनल ब्लॉकों | डीजल जनरेटर | इलेक्ट्रिकल और इलेक्...
- Delhi
- भारत
supplyautonomy.com/crystalhomeappliancesindia.in
Ask it and you have it with CRYSTAL HOME APPLIANCES (INDIA) presenting a wide range of MLM products with guaranteed best price. We are one of the biggest names engaged in the domain of offering ... और पढ़ें »
- कस्टम सॉफ्टवेयर विकास सेवाओं | उपकरण सफाई | गैर अल्कोहल पेय पदार्थ | कपड़े | जेब | इलेक्ट्रिकल और इलेक्ट्रॉनिक उत्पादों ...
- Jaipur
- भारत
supplyautonomy.com/acmeinternational1.in
Established in 2003. Acme international is an exporters of machinery equipments for jewellery industries. We always strive to bring the latest and the best, keeping pace with
Technology, time and... और पढ़ें »
- एयर पर्दे | प्लास्टिक उत्पादों | इलेक्ट्रिकल और इलेक्ट्रॉनिक उत्पादों | आभूषण के लिए फर्नेस | आभूषण के लिए रोलिंग मिलों ...
- Mumbai
- भारत
supplyautonomy.com/srisaienterprises.in
EXPORT PACKERS in Gujarat
QUALITY PACKERS/vinyl packers/anti corrosive packaging
DISTRIBUTOR OF Valvoline Cummins ltd. Tectyl products.
Industrial lubricants distributors
Polka dotted hand... और पढ़ें »
- बिजली उत्पादन और वितरण उद्योग के लिए ठेकेदार | कूरियर सेवाओं | गेंद वाल्व | तितली वाल्व | बोरियों और बैग | बैग | प्लास्ट...
- Warangal
- भारत
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... और पढ़ें »
- सौर ऊर्जा उत्पादन | सौर ऊर्जा सलाहकार | लिथियम एक्युमुलेटरों | सौर उत्पादों और उपकरणों | सौर ऊर्जा उपकरण, निर्माताओं...
- Gurgaon
- भारत
supplyautonomy.com/zenithfilms.sg
At Zenith Window Films, we offer a spectrum of of 3m solar window films, 3m whiteboard films for home and window tinting in Singapore at cheap prices. We are dedicated to offer excellent service to... और पढ़ें »
- सौर उत्पादों और उपकरणों
- singapore
- सिंगापुर