Որոնման արդյունքները: Արեւային PRODUCTS & EQUIPMENT
Գտնվել է X կազմակերպությունsupplyautonomy.com/hincoopower.ph
Hincoo Power offers comprehensive solutions that hugely augment the peak power shortage, given the development of the local economy, industry, and commerce. It has supported the rapid growth of the... Կարդալ ավելին »
- Էլեկտրակայանների, արեւային էներգիայի | Արեւային Power գործարանը, ֆոտոգալվանային բջջային | Մոդուլներ | Արեւային ֆոտոգալվա...
- Shenzhen
- Չինաստան
supplyautonomy.com/placasar1es.es
supplyautonomy.com/geospec.in
We are into business of providing turnkey solutions in Lighting Green Energy Solutions viz. Solar Wind energy solutions. We are operating in both Goverment as well as private sector have... Կարդալ ավելին »
- Էլեկտրական բաղադրիչներ | Շիկացման լամպեր | Լամպեր եւ floodlights, ացետիլեն | Լամպեր, ձեթ | Հոգին լամպեր | Գազի լամպեր | ...
- Gurgaon
- Հնդկաստան
supplyautonomy.com/apexenterprises.in
You will pleased to know that we professional in setup second hand Rolling mill,Induction or Arc furnace, Industrial Machinery and electrical items such as all type of motors(DC AC),Turbines,water... Կարդալ ավելին »
- Շինարարական ծրագրեր | Մեկուսիչ նյութեր | Շինարարներ 'գործիքներ | Ստացիոնար | Դրամապանակներ | Capping եւ overcapping caps...
- Secunderabad
- Հնդկաստան
supplyautonomy.com/indotechindustrialsolutionspvt.in
We are a diversified technology leader, providing integrated automation and software solutions to various industries like technology, power, service sector, mobile pstn line operators,... Կարդալ ավելին »
- Կաթի փոշի | Հեռահաղորդակցման սարքավորումներ եւ համակարգեր | Էլեկտրոնային արտադրանքներ | Էլեկտրական բաղադրիչներ | Էլեկտրա...
- Pune
- Հնդկաստան
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Կարդալ ավելին »
- Անվտանգության արտադրանքի գործակալները | Փոխանցում տպագրություն | Ներարկման համաձուլվածքներ ծառայություններ, մետաղական | ...
- Amravati
- Հնդկաստան
supplyautonomy.com/laxmiindustries.in
Manufacturer and Exporters of Three Wheeler, Hand Operated Tricycles, Wheelchair, Walker, Crutches, Hearing Aids and Mopeds/Motor Cycles with Three Wheeler and Both Side Wheel Attachment System.
- FABRICATORS, ալյումինե | Շինարարներ 'գործիքներ | Ball փականներ | Butterfly փականներ | Ցորեն | Բժշկական կահույք | Տեքստիլ...
- Indore
- Հնդկաստան
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Կարդալ ավելին »
- Անվտանգության արտադրանքի գործակալները | Փոխանցում տպագրություն | Ներարկման համաձուլվածքներ ծառայություններ, մետաղական | ...
- Mumbai
- Հնդկաստան
supplyautonomy.com/yessolarsolutionscary.us
At Yes Solar Solutions, our unique advantage lies in our commitment to quality and the craftsmanship we bring to each project. We are the only NABCEP Accredited solar installer in North Carolina and... Կարդալ ավելին »
- Արեւային էներգիայի վահանակը տեղադրում | Solar վահանակ Տանիքների ծածկապատում | Արեւային վահանակներ | Արեւային վահանակ | Ա...
- Cary
- Ամէրիկայի Միացյալ Նահանգնէր
supplyautonomy.com/basantproductsindia.in
INTRODUCTION
M / S Basant Products (India) is a prestigious award winner for quality Marketing and three BIS licenses holder, manufacturer and Exporter of Diesel Generating Sets, Diesel Engines,... Կարդալ ավելին »
- Այլ ծառայություններ | Դիզելային գեներատորների | Էլեկտրական շարժիչի | Սննդի արդյունաբերություն բույսերի եւ սարքավորումներ...
- Agra
- Հնդկաստան
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Կարդալ ավելին »
- Անվտանգության արտադրանքի գործակալները | Փոխանցում տպագրություն | Ներարկման համաձուլվածքներ ծառայություններ, մետաղական | ...
- Faridabad
- Հնդկաստան
supplyautonomy.com/miplmanoharinternationalpvt.in
MIPL, one of the worlds most trusted brands, is a name with a long history that powers itself into new ventures. This trust extends to a series of products, services and solutions that cover diverse... Կարդալ ավելին »
- Ball փականներ | Butterfly փականներ | Պլաստմասսայից արտադրանք | Այլ փաթեթավորման նյութերը | Staples, մետաղալար | Quartz ք...
- Ahmedabad
- Հնդկաստան
supplyautonomy.com/citadelarchitecturalsolutionspvt.in
Citadel Architectural Solutions Pvt. Ltd., is an innovative company headquartered in Mumbai. Citadel works with a number of innovative roofing and cladding products and solutions, as well as... Կարդալ ավելին »
- Օդի purifiers | Տանիք | Դեկորատիվ բարձր ճնշման LAMINATES / HPL | Պլաստմասսայից արտադրանք | Պլաստիկ ֆիլմ | Էլեկտրոնային ն...
- Mumbai
- Հնդկաստան
supplyautonomy.com/babaenterprises.in
Baba Enterprises is a name to reckon with the spectrum of latest garment accessories. The business avenues of our company comprises of manufacturing, supplying and exporting a wide range of apparel... Կարդալ ավելին »
- Շինարարական ծրագրեր | Շինարարներ 'գործիքներ | Կահավորում | Էթնիկ Հագուստ | Գործվածքներ | Կարի rivets | Էլեկտրական բաղադր...
- New Delhi
- Հնդկաստան
supplyautonomy.com/ronakgroup.in
Ronak Rocks Pvt. Ltd. is a professionally managed organization engaged in the production of a variety of stone products in various sizes and finishes. Our range of natural stone and natural building... Կարդալ ավելին »
- Առողջապահական ծրագրեր | Զգեստ նախագծման ծառայություններ | Miscellaneous շենքը քարե | Էլեկտրական բաղադրիչներ | Մարտկոց տո...
- Vadodara
- Հնդկաստան
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade.
It has its offices at various places in India and has its global... Կարդալ ավելին »
- Մեքենաների աղմուկ մշակման ծառայություններ | Տեքստիլ թափոնների մշակման ծառայություններ, բուրդ | Տեքստիլ թափոնների մշակման...
- Mumbai
- Հնդկաստան
supplyautonomy.com/china.cn
supplyautonomy.com/jayagenciez.in
Jay Agenciez is an authorized agent in India for some of the worlds most famous Brands of Industrial Products. We are mainly into the Import and Export supplies of Industrial Consumables which are... Կարդալ ավելին »
- Մեկուսիչ նյութեր | Մաքրման սարքավորումներ | Պլաստմասսայից արտադրանք | Սոսինձներ եւ ժապավեն | Եռակցման սարքավորումներ | S...
- Surat
- Հնդկաստան
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Կարդալ ավելին »
- Անվտանգության արտադրանքի գործակալները | Փոխանցում տպագրություն | Ներարկման համաձուլվածքներ ծառայություններ, մետաղական | ...
- Ahmedabad
- Հնդկաստան
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Կարդալ ավելին »
- Անվտանգության արտադրանքի գործակալները | Փոխանցում տպագրություն | Ներարկման համաձուլվածքներ ծառայություններ, մետաղական | ...
- Bardoli
- Հնդկաստան
supplyautonomy.com/scientechtechnologiespvt.in
Scientech Technologies Pvt. Ltd. is an ISO 9001:2008 certified company that has a strong presence in educational, health care, environmental and industrial sectors. With more than 550 diverse... Կարդալ ավելին »
- Էլեկտրական եւ էլեկտրոնային արտադրանքները | Այլ հոսանքի աղբյուրներ | Արդյունաբերական էներգամատակարարման | Հորատանցքերի հո...
- Indore
- Հնդկաստան
supplyautonomy.com/spaceagesecuritysystems.in
Spaceage Security Systems Ltd. is an exporter of India Solar Lamps products. With a well management system, Sisale strives to offer the best quality products and service as possible as we can, as... Կարդալ ավելին »
- Հեռախոսային սարքեր | Հեռահաղորդակցման սարքավորումներ եւ համակարգեր | Էլեկտրոնային բաղադրիչներ | Էլեկտրոնային արտադրանքնե...
- Delhi
- Հնդկաստան
supplyautonomy.com/uniquecombustion.in
Company Brief Empowered with technological expertise and service support of a highly skilled workforce, we, Unique Combustion, have emerged as one of the leading manufacturers, exporters, importers,... Կարդալ ավելին »
- Բիզնես ճանապարհորդական փաթեթներ | Կաթսայատան մասեր | Այրիչներ, արդյունաբերական | Էլեկտրական շարժիչի | Էլեկտրական եւ էլեկ...
- New Delhi
- Հնդկաստան
supplyautonomy.com/trademaxenterprise.in
TradeMax Enterprise has been founded by a team of professionals with rich experience in international business and Trading. Our team has worked for years in sourcing of products and... Կարդալ ավելին »
- Գորգեր | Cable խցուկներ | Էլեկտրական շարժիչի | Փաթեթավորում մեքենաներ | Հագուստ | Coir արտադրանք | Ռետին եւ ռետինե արտադ...
- Mumbai
- Հնդկաստան
supplyautonomy.com/ganpatielectricalspvt.in
Profile
Established in the year 1998, Ganpati Electricals Pvt. Ltd. is amongst the leading manufacturers and traders of wide range of electrical equipment. We specialize in Servo Voltage... Կարդալ ավելին »
- Շինմոնտաժային է էլեկտրաէներգիայի արտադրության եւ բաշխման արդյունաբերության | Այլ ծառայություններ | Տերմինալ արգելափակում...
- Delhi
- Հնդկաստան
supplyautonomy.com/crystalhomeappliancesindia.in
Ask it and you have it with CRYSTAL HOME APPLIANCES (INDIA) presenting a wide range of MLM products with guaranteed best price. We are one of the biggest names engaged in the domain of offering ... Կարդալ ավելին »
- Պատվերով ծրագրային ապահովման զարգացման ծառայություններ | Մաքրման սարքավորումներ | Ոչ ալկոհոլային խմիչքներ | Գործվածքներ ...
- Jaipur
- Հնդկաստան
supplyautonomy.com/acmeinternational1.in
Established in 2003. Acme international is an exporters of machinery equipments for jewellery industries. We always strive to bring the latest and the best, keeping pace with
Technology, time and... Կարդալ ավելին »
- Օդային Վարագույրներ | Պլաստմասսայից արտադրանք | Էլեկտրական եւ էլեկտրոնային արտադրանքները | Վառարաններ եւ ոսկերչական | RO...
- Mumbai
- Հնդկաստան
supplyautonomy.com/srisaienterprises.in
EXPORT PACKERS in Gujarat
QUALITY PACKERS/vinyl packers/anti corrosive packaging
DISTRIBUTOR OF Valvoline Cummins ltd. Tectyl products.
Industrial lubricants distributors
Polka dotted hand... Կարդալ ավելին »
- Շինմոնտաժային է էլեկտրաէներգիայի արտադրության եւ բաշխման արդյունաբերության | Սուրհանդակային ծառայություններ | Ball փական...
- Warangal
- Հնդկաստան
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... Կարդալ ավելին »
- Արեւային էներգիայի արտադրություն | Արեւային էներգիայի խորհրդատուները | Lithium ակումուլյատորներ | Արեւային PRODUCTS & EQ...
- Gurgaon
- Հնդկաստան
supplyautonomy.com/zenithfilms.sg
At Zenith Window Films, we offer a spectrum of of 3m solar window films, 3m whiteboard films for home and window tinting in Singapore at cheap prices. We are dedicated to offer excellent service to... Կարդալ ավելին »
- Արեւային PRODUCTS & EQUIPMENT
- singapore
- Սինգապուր