Search Results for: Produk & peralatan solar
Syarikat 6323 Dijumpaisupplyautonomy.com/hincoopower.ph
Hincoo Power offers comprehensive solutions that hugely augment the peak power shortage, given the development of the local economy, industry, and commerce. It has supported the rapid growth of the... Read More »
- Stesen janakuasa, tenaga solar | Loji kuasa solar, sel photovoltaic | Modul | Pengesan solar untuk panel photovoltaic |...
- Shenzhen
- China
supplyautonomy.com/placasar1es.es
supplyautonomy.com/geospec.in
We are into business of providing turnkey solutions in Lighting Green Energy Solutions viz. Solar Wind energy solutions. We are operating in both Goverment as well as private sector have... Read More »
- Komponen elektrik | Lampu pijar | Lampu dan lampu limpah, asetilena | Lampu, minyak | Pelita | Lampu Gas | Lampu lilin...
- Gurgaon
- India
supplyautonomy.com/apexenterprises.in
You will pleased to know that we professional in setup second hand Rolling mill,Induction or Arc furnace, Industrial Machinery and electrical items such as all type of motors(DC AC),Turbines,water... Read More »
- Pembinaan projek-projek | Bahan penebat | Alat pembina ' | Tulis | Dompet | Sekatan dan overcapping kapsul, plastik |...
- Secunderabad
- India
supplyautonomy.com/indotechindustrialsolutionspvt.in
We are a diversified technology leader, providing integrated automation and software solutions to various industries like technology, power, service sector, mobile pstn line operators,... Read More »
- Susu tepung | Telekomunikasi - peralatan dan sistem | Bekalan Elektronik | Komponen elektrik | Barangan elektrik dan...
- Pune
- India
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Read More »
- Agen produk keselamatan | Percetakan pemindahan | Suntikan perkhidmatan, logam | Bahan penebat | Custom reka bentuk air...
- Amravati
- India
supplyautonomy.com/laxmiindustries.in
Manufacturer and Exporters of Three Wheeler, Hand Operated Tricycles, Wheelchair, Walker, Crutches, Hearing Aids and Mopeds/Motor Cycles with Three Wheeler and Both Side Wheel Attachment System.
- Fabrikasi, aluminium | Alat pembina ' | Injap bola | Rama-rama injap | Gandum | Perabot Perubatan | Produk berkaitan...
- Indore
- India
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Read More »
- Agen produk keselamatan | Percetakan pemindahan | Suntikan perkhidmatan, logam | Bahan penebat | Custom reka bentuk air...
- Mumbai
- India
supplyautonomy.com/yessolarsolutionscary.us
At Yes Solar Solutions, our unique advantage lies in our commitment to quality and the craftsmanship we bring to each project. We are the only NABCEP Accredited solar installer in North Carolina and... Read More »
- Tenaga solar pemasangan panel | Solar panel bumbung meliputi kerja | Panel solar | Panel solar | Produk & peralatan...
- Cary
- Amerika Syarikat
supplyautonomy.com/basantproductsindia.in
INTRODUCTION
M / S Basant Products (India) is a prestigious award winner for quality Marketing and three BIS licenses holder, manufacturer and Exporter of Diesel Generating Sets, Diesel Engines,... Read More »
- Perkhidmatan agensi lain | Generator diesel | Motor elektrik | Kilang industri makanan dan peralatan tstl | Jentera...
- Agra
- India
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Read More »
- Agen produk keselamatan | Percetakan pemindahan | Suntikan perkhidmatan, logam | Bahan penebat | Custom reka bentuk air...
- Faridabad
- India
supplyautonomy.com/miplmanoharinternationalpvt.in
MIPL, one of the worlds most trusted brands, is a name with a long history that powers itself into new ventures. This trust extends to a series of products, services and solutions that cover diverse... Read More »
- Injap bola | Rama-rama injap | Produk plastik | Bahan-bahan pembungkusan lain | Staples, wayar | Kuarza batu | Kacang |...
- Ahmedabad
- India
supplyautonomy.com/citadelarchitecturalsolutionspvt.in
Citadel Architectural Solutions Pvt. Ltd., is an innovative company headquartered in Mumbai. Citadel works with a number of innovative roofing and cladding products and solutions, as well as... Read More »
- Pembersih udara | Bumbung | Tekanan tinggi hiasan laminates / HPL | Produk plastik | Filem plastik | Tanda-tanda...
- Mumbai
- India
supplyautonomy.com/babaenterprises.in
Baba Enterprises is a name to reckon with the spectrum of latest garment accessories. The business avenues of our company comprises of manufacturing, supplying and exporting a wide range of apparel... Read More »
- Pembinaan projek-projek | Alat pembina ' | Memberikan | Pakaian Etnik | Kain | Rivet Garment | Komponen elektrik |...
- New Delhi
- India
supplyautonomy.com/ronakgroup.in
Ronak Rocks Pvt. Ltd. is a professionally managed organization engaged in the production of a variety of stone products in various sizes and finishes. Our range of natural stone and natural building... Read More »
- Projek-projek kesihatan | Perkhidmatan reka bentuk pakaian | Batu bangunan Pelbagai | Komponen elektrik | Pek bateri |...
- Vadodara
- India
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade.
It has its offices at various places in India and has its global... Read More »
- Mesin perkhidmatan pemprosesan tunda | Tekstil perkhidmatan pemprosesan sisa, bulu | Tekstil perkhidmatan pemprosesan...
- Mumbai
- India
supplyautonomy.com/china.cn
supplyautonomy.com/jayagenciez.in
Jay Agenciez is an authorized agent in India for some of the worlds most famous Brands of Industrial Products. We are mainly into the Import and Export supplies of Industrial Consumables which are... Read More »
- Bahan penebat | Peralatan pembersihan | Produk plastik | Pelekat dan pita | Peralatan kimpalan | Staples, wayar |...
- Surat
- India
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Read More »
- Agen produk keselamatan | Percetakan pemindahan | Suntikan perkhidmatan, logam | Bahan penebat | Custom reka bentuk air...
- Ahmedabad
- India
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Read More »
- Agen produk keselamatan | Percetakan pemindahan | Suntikan perkhidmatan, logam | Bahan penebat | Custom reka bentuk air...
- Bardoli
- India
supplyautonomy.com/scientechtechnologiespvt.in
Scientech Technologies Pvt. Ltd. is an ISO 9001:2008 certified company that has a strong presence in educational, health care, environmental and industrial sectors. With more than 550 diverse... Read More »
- Barangan elektrik dan elektronik | Bekalan kuasa lain | Bekalan kuasa industri | Jentera yang penggerudian | Peralatan...
- Indore
- India
supplyautonomy.com/spaceagesecuritysystems.in
Spaceage Security Systems Ltd. is an exporter of India Solar Lamps products. With a well management system, Sisale strives to offer the best quality products and service as possible as we can, as... Read More »
- Set telefon | Telekomunikasi - peralatan dan sistem | Komponen elektronik | Bekalan Elektronik | Komponen elektrik |...
- Delhi
- India
supplyautonomy.com/uniquecombustion.in
Company Brief Empowered with technological expertise and service support of a highly skilled workforce, we, Unique Combustion, have emerged as one of the leading manufacturers, exporters, importers,... Read More »
- Pakej pelancongan Perniagaan | Bahagian Dandang | Pembakar, perindustrian | Motor elektrik | Peralatan elektrik dan...
- New Delhi
- India
supplyautonomy.com/trademaxenterprise.in
TradeMax Enterprise has been founded by a team of professionals with rich experience in international business and Trading. Our team has worked for years in sourcing of products and... Read More »
- Permaidani | Cable kelenjar | Motor elektrik | Jentera pembungkusan | Pakaian | Coir produk | Getah & produk getah |...
- Mumbai
- India
supplyautonomy.com/ganpatielectricalspvt.in
Profile
Established in the year 1998, Ganpati Electricals Pvt. Ltd. is amongst the leading manufacturers and traders of wide range of electrical equipment. We specialize in Servo Voltage... Read More »
- Kontraktor untuk pengeluaran elektrik dan industri pengedaran | Perkhidmatan reka bentuk yang lain | Blok Terminal |...
- Delhi
- India
supplyautonomy.com/crystalhomeappliancesindia.in
Ask it and you have it with CRYSTAL HOME APPLIANCES (INDIA) presenting a wide range of MLM products with guaranteed best price. We are one of the biggest names engaged in the domain of offering ... Read More »
- Perkhidmatan pembangunan perisian adat | Peralatan pembersihan | Minuman bukan alkohol | Kain | Dompet | Barangan...
- Jaipur
- India
supplyautonomy.com/acmeinternational1.in
Established in 2003. Acme international is an exporters of machinery equipments for jewellery industries. We always strive to bring the latest and the best, keeping pace with
Technology, time and... Read More »
- Tirai gelap terus Penyamanan | Produk plastik | Barangan elektrik dan elektronik | Relau untuk barang kemas | Rolling...
- Mumbai
- India
supplyautonomy.com/srisaienterprises.in
EXPORT PACKERS in Gujarat
QUALITY PACKERS/vinyl packers/anti corrosive packaging
DISTRIBUTOR OF Valvoline Cummins ltd. Tectyl products.
Industrial lubricants distributors
Polka dotted hand... Read More »
- Kontraktor untuk pengeluaran elektrik dan industri pengedaran | Perkhidmatan kurier | Injap bola | Rama-rama injap |...
- Warangal
- India
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... Read More »
- Pengeluaran tenaga solar | Perunding tenaga solar | Akumulator Lithium | Produk & peralatan solar | Peralatan tenaga...
- Gurgaon
- India
supplyautonomy.com/zenithfilms.sg
At Zenith Window Films, we offer a spectrum of of 3m solar window films, 3m whiteboard films for home and window tinting in Singapore at cheap prices. We are dedicated to offer excellent service to... Read More »
- Produk & peralatan solar
- singapore
- Singapura