Loading...
Резултати претраге: Соларни производи и опрема
Фоунд 6323 компаније
supplyautonomy.com/hincoopower.ph
Hincoo Power offers comprehensive solutions that hugely augment the peak power shortage, given the development of the local economy, industry, and commerce. It has supported the rapid growth of the... Прочитајте више »
- Снага, соларна енергија | Фабрика користи соларне енергије фотонапонских ћелија | Модули | Трекбекови за фотонапонских с...
- Shenzhen
- Кина
supplyautonomy.com/placasar1es.es
supplyautonomy.com/geospec.in
We are into business of providing turnkey solutions in Lighting Green Energy Solutions viz. Solar Wind energy solutions. We are operating in both Goverment as well as private sector have... Прочитајте више »
- Електричне компоненте | Филамент | Ацетилен лампе и фарови | Уљане лампе | Шпиритне лампе | Осветљење пропан и бутан | Л...
- Gurgaon
- Индија
supplyautonomy.com/apexenterprises.in
You will pleased to know that we professional in setup second hand Rolling mill,Induction or Arc furnace, Industrial Machinery and electrical items such as all type of motors(DC AC),Turbines,water... Прочитајте више »
- Грађевински пројекти | Изолациони материјали | Грађевински алати | Прибор за писање | Портфељ | Капсуле од пластичног ма...
- Secunderabad
- Индија
supplyautonomy.com/indotechindustrialsolutionspvt.in
We are a diversified technology leader, providing integrated automation and software solutions to various industries like technology, power, service sector, mobile pstn line operators,... Прочитајте више »
- Млеко у праху | Телекомуникације - уређаји и системи | Електронска опрема | Електричне компоненте | Електрични и електро...
- Pune
- Индија
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Прочитајте више »
- Безбедност производа агенти | Трансфер штампу | БРИЗГАЊЕ, метални | Изолациони материјали | Цустом дизајн опруге | Спојн...
- Amravati
- Индија
supplyautonomy.com/laxmiindustries.in
Manufacturer and Exporters of Three Wheeler, Hand Operated Tricycles, Wheelchair, Walker, Crutches, Hearing Aids and Mopeds/Motor Cycles with Three Wheeler and Both Side Wheel Attachment System.
- Производња алуминијума | Грађевински алати | Лоптасте славине | Залистак | Пшеница | Медицинска намештај | Текстилни сли...
- Indore
- Индија
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Прочитајте више »
- Безбедност производа агенти | Трансфер штампу | БРИЗГАЊЕ, метални | Изолациони материјали | Цустом дизајн опруге | Спојн...
- Mumbai
- Индија
supplyautonomy.com/yessolarsolutionscary.us
At Yes Solar Solutions, our unique advantage lies in our commitment to quality and the craftsmanship we bring to each project. We are the only NABCEP Accredited solar installer in North Carolina and... Прочитајте више »
- Инсталацију соларних колектора | Кровни рад са соларним панелима | Соларне ћелије | Соларни панел | Соларни производи и ...
- Cary
- Сједињене Америчке Државе
supplyautonomy.com/basantproductsindia.in
INTRODUCTION
M / S Basant Products (India) is a prestigious award winner for quality Marketing and three BIS licenses holder, manufacturer and Exporter of Diesel Generating Sets, Diesel Engines,... Прочитајте више »
- Остале агенцијске услуге | Дизел генератори | Електромотори | Индустријска опрема за прехрамбену индустрију, друге | Маш...
- Agra
- Индија
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Прочитајте више »
- Безбедност производа агенти | Трансфер штампу | БРИЗГАЊЕ, метални | Изолациони материјали | Цустом дизајн опруге | Спојн...
- Faridabad
- Индија
supplyautonomy.com/miplmanoharinternationalpvt.in
MIPL, one of the worlds most trusted brands, is a name with a long history that powers itself into new ventures. This trust extends to a series of products, services and solutions that cover diverse... Прочитајте више »
- Лоптасте славине | Залистак | Производи од пластике | Остали материјали за паковање | Окови, жица | Кремен | Луд | Нерђа...
- Ahmedabad
- Индија
supplyautonomy.com/citadelarchitecturalsolutionspvt.in
Citadel Architectural Solutions Pvt. Ltd., is an innovative company headquartered in Mumbai. Citadel works with a number of innovative roofing and cladding products and solutions, as well as... Прочитајте више »
- Пречишћивача ваздуха | Кров | Декоративни високог притиска ламинати / ХПЛ | Производи од пластике | Филмови за пластични...
- Mumbai
- Индија
supplyautonomy.com/babaenterprises.in
Baba Enterprises is a name to reckon with the spectrum of latest garment accessories. The business avenues of our company comprises of manufacturing, supplying and exporting a wide range of apparel... Прочитајте више »
- Грађевински пројекти | Грађевински алати | Опрема ентеријера | Етничке Текстила | Роба | Хаљину нитне | Електричне компо...
- New Delhi
- Индија
supplyautonomy.com/ronakgroup.in
Ronak Rocks Pvt. Ltd. is a professionally managed organization engaged in the production of a variety of stone products in various sizes and finishes. Our range of natural stone and natural building... Прочитајте више »
- Здравствени пројекти | Одећа Дизајн Услуге | Остало грађевински камен | Електричне компоненте | Батерије | Ђубриво | Фар...
- Vadodara
- Индија
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade.
It has its offices at various places in India and has its global... Прочитајте више »
- Обрада задњу вучу машине | Третман отпада текстила, вуне | Обрада тексилних отпада коса | Третман отпада текстила, памук...
- Mumbai
- Индија
supplyautonomy.com/china.cn
supplyautonomy.com/jayagenciez.in
Jay Agenciez is an authorized agent in India for some of the worlds most famous Brands of Industrial Products. We are mainly into the Import and Export supplies of Industrial Consumables which are... Прочитајте више »
- Изолациони материјали | Чишћење опреме | Производи од пластике | Лепкови и траке | Опрема за заваривање | Окови, жица | ...
- Surat
- Индија
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Прочитајте више »
- Безбедност производа агенти | Трансфер штампу | БРИЗГАЊЕ, метални | Изолациони материјали | Цустом дизајн опруге | Спојн...
- Ahmedabad
- Индија
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Прочитајте више »
- Безбедност производа агенти | Трансфер штампу | БРИЗГАЊЕ, метални | Изолациони материјали | Цустом дизајн опруге | Спојн...
- Bardoli
- Индија
supplyautonomy.com/scientechtechnologiespvt.in
Scientech Technologies Pvt. Ltd. is an ISO 9001:2008 certified company that has a strong presence in educational, health care, environmental and industrial sectors. With more than 550 diverse... Прочитајте више »
- Електрични и електронски производи | Остали извори напајања | Индустријска напајања | Машине за бушење | Електрична и ел...
- Indore
- Индија
supplyautonomy.com/spaceagesecuritysystems.in
Spaceage Security Systems Ltd. is an exporter of India Solar Lamps products. With a well management system, Sisale strives to offer the best quality products and service as possible as we can, as... Прочитајте више »
- Телефони | Телекомуникације - уређаји и системи | Електронске компоненте | Електронска опрема | Електричне компоненте | ...
- Delhi
- Индија
supplyautonomy.com/uniquecombustion.in
Company Brief Empowered with technological expertise and service support of a highly skilled workforce, we, Unique Combustion, have emerged as one of the leading manufacturers, exporters, importers,... Прочитајте више »
- Пословна путовања пакети | Делови котла | Горионици, индустријски | Електромотори | Електрична и електронска опрема | Со...
- New Delhi
- Индија
supplyautonomy.com/trademaxenterprise.in
TradeMax Enterprise has been founded by a team of professionals with rich experience in international business and Trading. Our team has worked for years in sourcing of products and... Прочитајте више »
- Теписи | Језгро кабла, електричне | Електромотори | Машине за паковање | Одећа | Цоир производи | Гума и гумени производ...
- Mumbai
- Индија
supplyautonomy.com/ganpatielectricalspvt.in
Profile
Established in the year 1998, Ganpati Electricals Pvt. Ltd. is amongst the leading manufacturers and traders of wide range of electrical equipment. We specialize in Servo Voltage... Прочитајте више »
- Извођачи у производњи и дистрибуцији електричне енергије | Остале услуге дизајна | Прикључни блокови | Дизел генератори ...
- Delhi
- Индија
supplyautonomy.com/crystalhomeappliancesindia.in
Ask it and you have it with CRYSTAL HOME APPLIANCES (INDIA) presenting a wide range of MLM products with guaranteed best price. We are one of the biggest names engaged in the domain of offering ... Прочитајте више »
- Развој услуга, прилагођени софтвер корисника | Чишћење опреме | Безалкохолна пића | Роба | Портфељ | Електрични и електр...
- Jaipur
- Индија
supplyautonomy.com/acmeinternational1.in
Established in 2003. Acme international is an exporters of machinery equipments for jewellery industries. We always strive to bring the latest and the best, keeping pace with
Technology, time and... Прочитајте више »
- Ваздушне завесе | Производи од пластике | Електрични и електронски производи | Пећи за Накит | Машине за ваљање за Накит...
- Mumbai
- Индија
supplyautonomy.com/srisaienterprises.in
EXPORT PACKERS in Gujarat
QUALITY PACKERS/vinyl packers/anti corrosive packaging
DISTRIBUTOR OF Valvoline Cummins ltd. Tectyl products.
Industrial lubricants distributors
Polka dotted hand... Прочитајте више »
- Извођачи у производњи и дистрибуцији електричне енергије | Курирске услуге | Лоптасте славине | Залистак | Вреће и кесе ...
- Warangal
- Индија
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... Прочитајте више »
- Соларна енергија за производњу | Технички савети на соларну енергију | Литијум батерије | Соларни производи и опрема | С...
- Gurgaon
- Индија
supplyautonomy.com/zenithfilms.sg
At Zenith Window Films, we offer a spectrum of of 3m solar window films, 3m whiteboard films for home and window tinting in Singapore at cheap prices. We are dedicated to offer excellent service to... Прочитајте више »
- Соларни производи и опрема
- singapore
- Сингапур