Loading...
தேடல் முடிவுகள்: சூரிய பொருட்கள் & உபகரணங்கள்
காணப்படும் 6323 நிறுவனங்கள்
supplyautonomy.com/hincoopower.ph
Hincoo Power offers comprehensive solutions that hugely augment the peak power shortage, given the development of the local economy, industry, and commerce. It has supported the rapid growth of the... மேலும் வாசிக்க »
- மின் நிலையங்கள், சூரிய ஆற்றல் | சூரிய மின்சக்தி ஆலை, ஒளிமின்னழுத்த மின்கலம் | தொகுதிகள் | ஒளிமின்னழுத்த பேனல்கள் ஐந்து ...
- Shenzhen
- சீனா
supplyautonomy.com/placasar1es.es
supplyautonomy.com/geospec.in
We are into business of providing turnkey solutions in Lighting Green Energy Solutions viz. Solar Wind energy solutions. We are operating in both Goverment as well as private sector have... மேலும் வாசிக்க »
- மின் கூறுகளை | ஒளிரும் விளக்குகள் | விளக்குகள் மற்றும் ஃப்ளட்லைட் விளக்குகள், அசற்றலன் | விளக்குகள், எண்ணெய் | ஆவி விளக்...
- Gurgaon
- இந்தியா
supplyautonomy.com/apexenterprises.in
You will pleased to know that we professional in setup second hand Rolling mill,Induction or Arc furnace, Industrial Machinery and electrical items such as all type of motors(DC AC),Turbines,water... மேலும் வாசிக்க »
- கட்டுமான திட்டங்கள் | காப்பு பொருட்கள் | அடுக்கு மாடி 'கருவிகள் | காகிதம் முதலிய எழுது பொருள்கள் | பணப்பைகள் | உறை மற்...
- Secunderabad
- இந்தியா
supplyautonomy.com/indotechindustrialsolutionspvt.in
We are a diversified technology leader, providing integrated automation and software solutions to various industries like technology, power, service sector, mobile pstn line operators,... மேலும் வாசிக்க »
- பால்பொடி | தொலைத்தொடர்பு - உபகரணங்கள் மற்றும் அமைப்புகள் | மின்னணு பொருட்கள் | மின் கூறுகளை | மின் மற்றும் மின்னணு ப...
- Pune
- இந்தியா
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... மேலும் வாசிக்க »
- பாதுகாப்பு தயாரிப்பு முகவர் | பரிமாற்ற அச்சிடும் | ஊசி மருந்து வடிவமைத்தல் சேவைகள், உலோக | காப்பு பொருட்கள் | விருப்ப ...
- Amravati
- இந்தியா
supplyautonomy.com/laxmiindustries.in
Manufacturer and Exporters of Three Wheeler, Hand Operated Tricycles, Wheelchair, Walker, Crutches, Hearing Aids and Mopeds/Motor Cycles with Three Wheeler and Both Side Wheel Attachment System.
- கட்டமைப்பாளர், அலுமினியம் | அடுக்கு மாடி 'கருவிகள் | பந்து வால்வுகள் | பட்டாம்பூச்சி வால்வுகள் | கோதுமை | மருத்துவ மரச்...
- Indore
- இந்தியா
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... மேலும் வாசிக்க »
- பாதுகாப்பு தயாரிப்பு முகவர் | பரிமாற்ற அச்சிடும் | ஊசி மருந்து வடிவமைத்தல் சேவைகள், உலோக | காப்பு பொருட்கள் | விருப்ப ...
- Mumbai
- இந்தியா
supplyautonomy.com/yessolarsolutionscary.us
At Yes Solar Solutions, our unique advantage lies in our commitment to quality and the craftsmanship we bring to each project. We are the only NABCEP Accredited solar installer in North Carolina and... மேலும் வாசிக்க »
- சூரிய ஆற்றல் குழு நிறுவல் | சோலார் பேனல் கூரை மூடுதல் வேலை | சோலார் பேனல்கள் | சோலார் பேனல் | சூரிய பொருட்கள் & உபகர...
- Cary
- ஐக்கிய அமெரிக்க குடியரசு
supplyautonomy.com/basantproductsindia.in
INTRODUCTION
M / S Basant Products (India) is a prestigious award winner for quality Marketing and three BIS licenses holder, manufacturer and Exporter of Diesel Generating Sets, Diesel Engines,... மேலும் வாசிக்க »
- மற்ற நிறுவனத்தில் சேவைகள் | டீசல் ஜெனரேட்டர்கள் | மின்னோடி | உணவு துறை ஆலை மற்றும் உபகரணங்கள் NES | நன்கு தோண்டும் எந்...
- Agra
- இந்தியா
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... மேலும் வாசிக்க »
- பாதுகாப்பு தயாரிப்பு முகவர் | பரிமாற்ற அச்சிடும் | ஊசி மருந்து வடிவமைத்தல் சேவைகள், உலோக | காப்பு பொருட்கள் | விருப்ப ...
- Faridabad
- இந்தியா
supplyautonomy.com/miplmanoharinternationalpvt.in
MIPL, one of the worlds most trusted brands, is a name with a long history that powers itself into new ventures. This trust extends to a series of products, services and solutions that cover diverse... மேலும் வாசிக்க »
- பந்து வால்வுகள் | பட்டாம்பூச்சி வால்வுகள் | பிளாஸ்டிக் பொருட்கள் | பிற பேக்கேஜிங் பொருட்கள் | ஸ்டேபிள்ஸ், கம்பி | குவா...
- Ahmedabad
- இந்தியா
supplyautonomy.com/citadelarchitecturalsolutionspvt.in
Citadel Architectural Solutions Pvt. Ltd., is an innovative company headquartered in Mumbai. Citadel works with a number of innovative roofing and cladding products and solutions, as well as... மேலும் வாசிக்க »
- ஏர் purifiers | கூரை | அலங்கார உயர் அழுத்த / hpl LAMINATES | பிளாஸ்டிக் பொருட்கள் | பிளாஸ்டிக் படம் | மின்னணு அறிகுறிகள...
- Mumbai
- இந்தியா
supplyautonomy.com/babaenterprises.in
Baba Enterprises is a name to reckon with the spectrum of latest garment accessories. The business avenues of our company comprises of manufacturing, supplying and exporting a wide range of apparel... மேலும் வாசிக்க »
- கட்டுமான திட்டங்கள் | அடுக்கு மாடி 'கருவிகள் | நிறுவுதல் | பாரம்பரிய ஆடைகள் | துணிகள் | ஆடை rivets | மின் கூறுகளை | நன்க...
- New Delhi
- இந்தியா
supplyautonomy.com/ronakgroup.in
Ronak Rocks Pvt. Ltd. is a professionally managed organization engaged in the production of a variety of stone products in various sizes and finishes. Our range of natural stone and natural building... மேலும் வாசிக்க »
- சுகாதார திட்டங்கள் | ஆடை வடிவமைப்பு சேவைகள் | இதர கட்டிட கல் | மின் கூறுகளை | மின்கலன் கட்டு | உர | மருந்து கட்டுரைகள் |...
- Vadodara
- இந்தியா
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade.
It has its offices at various places in India and has its global... மேலும் வாசிக்க »
- இயந்திரம் கயிறு செயலாக்க சேவைகள் | ஜவுளி கழிவு சுத்திகரிப்பு சேவைகளை, கம்பளி | ஜவுளி கழிவு சுத்திகரிப்பு சேவைகளை, முடி |...
- Mumbai
- இந்தியா
supplyautonomy.com/china.cn
supplyautonomy.com/jayagenciez.in
Jay Agenciez is an authorized agent in India for some of the worlds most famous Brands of Industrial Products. We are mainly into the Import and Export supplies of Industrial Consumables which are... மேலும் வாசிக்க »
- காப்பு பொருட்கள் | உபகரணங்கள் சுத்தம் | பிளாஸ்டிக் பொருட்கள் | ஒட்டிகள் மற்றும் நாடா | வெல்டிங் உபகரணங்கள் | ஸ்டேபிள்ஸ...
- Surat
- இந்தியா
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... மேலும் வாசிக்க »
- பாதுகாப்பு தயாரிப்பு முகவர் | பரிமாற்ற அச்சிடும் | ஊசி மருந்து வடிவமைத்தல் சேவைகள், உலோக | காப்பு பொருட்கள் | விருப்ப ...
- Ahmedabad
- இந்தியா
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... மேலும் வாசிக்க »
- பாதுகாப்பு தயாரிப்பு முகவர் | பரிமாற்ற அச்சிடும் | ஊசி மருந்து வடிவமைத்தல் சேவைகள், உலோக | காப்பு பொருட்கள் | விருப்ப ...
- Bardoli
- இந்தியா
supplyautonomy.com/scientechtechnologiespvt.in
Scientech Technologies Pvt. Ltd. is an ISO 9001:2008 certified company that has a strong presence in educational, health care, environmental and industrial sectors. With more than 550 diverse... மேலும் வாசிக்க »
- மின் மற்றும் மின்னணு பொருட்கள் | மற்ற மின் விநியோகம் | தொழில்துறை மின்சாரம் | நன்கு தோண்டும் எந்திரங்கள் | மின் மற்ற...
- Indore
- இந்தியா
supplyautonomy.com/spaceagesecuritysystems.in
Spaceage Security Systems Ltd. is an exporter of India Solar Lamps products. With a well management system, Sisale strives to offer the best quality products and service as possible as we can, as... மேலும் வாசிக்க »
- தொலைபேசி கருவிகள் | தொலைத்தொடர்பு - உபகரணங்கள் மற்றும் அமைப்புகள் | மின்னணு பாகங்கள் | மின்னணு பொருட்கள் | மின் கூறு...
- Delhi
- இந்தியா
supplyautonomy.com/uniquecombustion.in
Company Brief Empowered with technological expertise and service support of a highly skilled workforce, we, Unique Combustion, have emerged as one of the leading manufacturers, exporters, importers,... மேலும் வாசிக்க »
- வணிக பயண பொதிகள் | கொதிகலன் பாகங்கள் | பர்னர்கள், தொழில்துறை | மின்னோடி | மின் மற்றும் மின்னணு உபகரணங்கள் | சூரிய பெ...
- New Delhi
- இந்தியா
supplyautonomy.com/trademaxenterprise.in
TradeMax Enterprise has been founded by a team of professionals with rich experience in international business and Trading. Our team has worked for years in sourcing of products and... மேலும் வாசிக்க »
- தரை | கேபிள் சுரப்பிகள் | மின்னோடி | பேக்கேஜிங் இயந்திரங்கள் | ஆடை | தென்னை பொருட்கள் | ரப்பர் மற்றும் ரப்பர் பொருட்க...
- Mumbai
- இந்தியா
supplyautonomy.com/ganpatielectricalspvt.in
Profile
Established in the year 1998, Ganpati Electricals Pvt. Ltd. is amongst the leading manufacturers and traders of wide range of electrical equipment. We specialize in Servo Voltage... மேலும் வாசிக்க »
- மின்சார உற்பத்தி மற்றும் விநியோகம் துறையில் ஒப்பந்தக்காரர்கள் | மற்ற வடிவமைப்பு சேவைகள் | முனையத்தில் தொகுதிகள் | டீசல...
- Delhi
- இந்தியா
supplyautonomy.com/crystalhomeappliancesindia.in
Ask it and you have it with CRYSTAL HOME APPLIANCES (INDIA) presenting a wide range of MLM products with guaranteed best price. We are one of the biggest names engaged in the domain of offering ... மேலும் வாசிக்க »
- மென்பொருள் உருவாக்கம் சேவைகள் | உபகரணங்கள் சுத்தம் | அல்லாத மதுபானங்களை | துணிகள் | பணப்பைகள் | மின் மற்றும் மின்னணு பெ...
- Jaipur
- இந்தியா
supplyautonomy.com/acmeinternational1.in
Established in 2003. Acme international is an exporters of machinery equipments for jewellery industries. We always strive to bring the latest and the best, keeping pace with
Technology, time and... மேலும் வாசிக்க »
- காற்று திரைச்சீலைகள் | பிளாஸ்டிக் பொருட்கள் | மின் மற்றும் மின்னணு பொருட்கள் | நகை உலைகளில் | நகை ரோலிங் மில் | நகைகள...
- Mumbai
- இந்தியா
supplyautonomy.com/srisaienterprises.in
EXPORT PACKERS in Gujarat
QUALITY PACKERS/vinyl packers/anti corrosive packaging
DISTRIBUTOR OF Valvoline Cummins ltd. Tectyl products.
Industrial lubricants distributors
Polka dotted hand... மேலும் வாசிக்க »
- மின்சார உற்பத்தி மற்றும் விநியோகம் துறையில் ஒப்பந்தக்காரர்கள் | கூரியர் சேவைகள் | பந்து வால்வுகள் | பட்டாம்பூச்சி வால்வ...
- Warangal
- இந்தியா
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... மேலும் வாசிக்க »
- சூரிய எரிசக்தி உற்பத்தி | சூரிய ஆற்றல் நிபுணர்கள் | லித்தியம் accumulators | சூரிய பொருட்கள் & உபகரணங்கள் | சூரிய சக்தி...
- Gurgaon
- இந்தியா
supplyautonomy.com/zenithfilms.sg
At Zenith Window Films, we offer a spectrum of of 3m solar window films, 3m whiteboard films for home and window tinting in Singapore at cheap prices. We are dedicated to offer excellent service to... மேலும் வாசிக்க »
- சூரிய பொருட்கள் & உபகரணங்கள்
- singapore
- சிங்கப்பூர்