Loading...
కోసం శోధన ఫలితాలు: సౌర ఉత్పత్తులు & పరికరాలు
దొరకలేదు 6323 కంపెనీలు
supplyautonomy.com/hincoopower.ph
Hincoo Power offers comprehensive solutions that hugely augment the peak power shortage, given the development of the local economy, industry, and commerce. It has supported the rapid growth of the... మరింత చదవండి »
- పవర్ స్టేషన్లు, సౌర శక్తి | సౌర విద్యుత్ కేంద్రం, కాంతివిపీడన ఘటం | గుణకాలు | ఫోటోవోల్టాయిక్ ప్యానెళ్లు సౌర గుర్తించేవి ...
- Shenzhen
- చైనా
supplyautonomy.com/placasar1es.es
supplyautonomy.com/geospec.in
We are into business of providing turnkey solutions in Lighting Green Energy Solutions viz. Solar Wind energy solutions. We are operating in both Goverment as well as private sector have... మరింత చదవండి »
- విద్యుత్ భాగాలు | జ్వలించే దీపాలను | లాంప్స్ మరియు ఫ్లడ్లలైట్లతో, ఎసిటిలీన్ | లాంప్స్, చమురు | స్పిరిట్ దీపములు | గ్యాస...
- Gurgaon
- భారత దేశం
supplyautonomy.com/apexenterprises.in
You will pleased to know that we professional in setup second hand Rolling mill,Induction or Arc furnace, Industrial Machinery and electrical items such as all type of motors(DC AC),Turbines,water... మరింత చదవండి »
- నిర్మాణాలు | ఇన్సులేషన్ పదార్థాలు | బిల్డర్ల 'టూల్స్ | స్టేషనరీ | పర్సులు | పరిమితి మరియు overcapping గుళికలు, ప్లాస్టిక...
- Secunderabad
- భారత దేశం
supplyautonomy.com/indotechindustrialsolutionspvt.in
We are a diversified technology leader, providing integrated automation and software solutions to various industries like technology, power, service sector, mobile pstn line operators,... మరింత చదవండి »
- పాలపొడి | టెలికమ్యూనికేషన్స్ - పరికరాలు మరియు వ్యవస్థలు | ఎలక్ట్రానిక్ సరఫరా | విద్యుత్ భాగాలు | విద్యుత్ మరియు ఎలక్ట్రా...
- Pune
- భారత దేశం
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... మరింత చదవండి »
- సెక్యూరిటీ ఉత్పత్తి ఎజెంట్ | బదిలీ ముద్రణ | ఇంజెక్షన్ మౌల్డింగ్ సేవలు, మెటల్ | ఇన్సులేషన్ పదార్థాలు | కస్టమ్ డిజైన్ SPR...
- Amravati
- భారత దేశం
supplyautonomy.com/laxmiindustries.in
Manufacturer and Exporters of Three Wheeler, Hand Operated Tricycles, Wheelchair, Walker, Crutches, Hearing Aids and Mopeds/Motor Cycles with Three Wheeler and Both Side Wheel Attachment System.
- FABRICATORS, అల్యూమినియం | బిల్డర్ల 'టూల్స్ | బాల్ కవాటాలు | సీతాకోకచిలుక కవాటాలు | గోధుమలు | మెడికల్ ఫర్నిచర్ | వస్త్ర ...
- Indore
- భారత దేశం
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... మరింత చదవండి »
- సెక్యూరిటీ ఉత్పత్తి ఎజెంట్ | బదిలీ ముద్రణ | ఇంజెక్షన్ మౌల్డింగ్ సేవలు, మెటల్ | ఇన్సులేషన్ పదార్థాలు | కస్టమ్ డిజైన్ SPR...
- Mumbai
- భారత దేశం
supplyautonomy.com/yessolarsolutionscary.us
At Yes Solar Solutions, our unique advantage lies in our commitment to quality and the craftsmanship we bring to each project. We are the only NABCEP Accredited solar installer in North Carolina and... మరింత చదవండి »
- సౌర శక్తి ప్యానెల్ సంస్థాపన | సోలార్ ప్యానల్ పైకప్పు-పూతను పని | సౌర ఫలకాలను | సోలార్ ప్యానల్ | సౌర ఉత్పత్తులు & పరికరా...
- Cary
- సంయుక్త రాజ్య అమెరికా
supplyautonomy.com/basantproductsindia.in
INTRODUCTION
M / S Basant Products (India) is a prestigious award winner for quality Marketing and three BIS licenses holder, manufacturer and Exporter of Diesel Generating Sets, Diesel Engines,... మరింత చదవండి »
- ఇతర ఏజెన్సీ సర్వీసెస్ | డీజిల్ జనరేటర్లు | ఎలక్ట్రిక్ మోటార్ | ఆహార పరిశ్రమ మొక్క మరియు పరికరాలు NES | బాగా డ్రిల్లింగ్ ...
- Agra
- భారత దేశం
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... మరింత చదవండి »
- సెక్యూరిటీ ఉత్పత్తి ఎజెంట్ | బదిలీ ముద్రణ | ఇంజెక్షన్ మౌల్డింగ్ సేవలు, మెటల్ | ఇన్సులేషన్ పదార్థాలు | కస్టమ్ డిజైన్ SPR...
- Faridabad
- భారత దేశం
supplyautonomy.com/miplmanoharinternationalpvt.in
MIPL, one of the worlds most trusted brands, is a name with a long history that powers itself into new ventures. This trust extends to a series of products, services and solutions that cover diverse... మరింత చదవండి »
- బాల్ కవాటాలు | సీతాకోకచిలుక కవాటాలు | ప్లాస్టిక్ ఉత్పత్తులు | ఇతర పాకేజింగ్ సామాగ్రికి | స్టేపుల్స్, వైర్ | క్వార్ట్జ్ ...
- Ahmedabad
- భారత దేశం
supplyautonomy.com/citadelarchitecturalsolutionspvt.in
Citadel Architectural Solutions Pvt. Ltd., is an innovative company headquartered in Mumbai. Citadel works with a number of innovative roofing and cladding products and solutions, as well as... మరింత చదవండి »
- ఎయిర్ శుభ్రపరిచే | చూరు | అలంకార అధిక ఒత్తిడి / hpl LAMINATES | ప్లాస్టిక్ ఉత్పత్తులు | ప్లాస్టిక్ చిత్రం | ఎలక్ట్రానిక్...
- Mumbai
- భారత దేశం
supplyautonomy.com/babaenterprises.in
Baba Enterprises is a name to reckon with the spectrum of latest garment accessories. The business avenues of our company comprises of manufacturing, supplying and exporting a wide range of apparel... మరింత చదవండి »
- నిర్మాణాలు | బిల్డర్ల 'టూల్స్ | ఫర్నిషింగ్ | భారతీయ దుస్తులు | బట్టలు | గార్మెంట్ ఉట్టచీలలను | విద్యుత్ భాగాలు | బాగా డ్...
- New Delhi
- భారత దేశం
supplyautonomy.com/ronakgroup.in
Ronak Rocks Pvt. Ltd. is a professionally managed organization engaged in the production of a variety of stone products in various sizes and finishes. Our range of natural stone and natural building... మరింత చదవండి »
- ఆరోగ్యం ప్రాజెక్టులు | దుస్తులు డిజైన్ సేవలు | ఇతరాలు కట్టడ రాయి | విద్యుత్ భాగాలు | బ్యాటరీ ప్యాక్ల | ఎరువు | ఫార్మాస్...
- Vadodara
- భారత దేశం
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade.
It has its offices at various places in India and has its global... మరింత చదవండి »
- యంత్రం లాగుకొని పోవు ప్రాసెసింగ్ సేవలు | వస్త్ర వ్యర్థాలు ప్రాసెసింగ్ సేవలు, ఉన్ని | వస్త్ర వ్యర్థాలు ప్రాసెసింగ్ సేవలు,...
- Mumbai
- భారత దేశం
supplyautonomy.com/china.cn
supplyautonomy.com/jayagenciez.in
Jay Agenciez is an authorized agent in India for some of the worlds most famous Brands of Industrial Products. We are mainly into the Import and Export supplies of Industrial Consumables which are... మరింత చదవండి »
- ఇన్సులేషన్ పదార్థాలు | పరికరాలు క్లీనింగ్ | ప్లాస్టిక్ ఉత్పత్తులు | సంసంజనాలు మరియు టేప్ | వెల్డింగ్ పరికరాలు | స్టేపుల్...
- Surat
- భారత దేశం
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... మరింత చదవండి »
- సెక్యూరిటీ ఉత్పత్తి ఎజెంట్ | బదిలీ ముద్రణ | ఇంజెక్షన్ మౌల్డింగ్ సేవలు, మెటల్ | ఇన్సులేషన్ పదార్థాలు | కస్టమ్ డిజైన్ SPR...
- Ahmedabad
- భారత దేశం
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... మరింత చదవండి »
- సెక్యూరిటీ ఉత్పత్తి ఎజెంట్ | బదిలీ ముద్రణ | ఇంజెక్షన్ మౌల్డింగ్ సేవలు, మెటల్ | ఇన్సులేషన్ పదార్థాలు | కస్టమ్ డిజైన్ SPR...
- Bardoli
- భారత దేశం
supplyautonomy.com/scientechtechnologiespvt.in
Scientech Technologies Pvt. Ltd. is an ISO 9001:2008 certified company that has a strong presence in educational, health care, environmental and industrial sectors. With more than 550 diverse... మరింత చదవండి »
- విద్యుత్ మరియు ఎలక్ట్రానిక్ ఉత్పత్తులు | ఇతర విద్యుత్ సరఫరాలకు | పారిశ్రామిక విద్యుత్ సరఫరా | బాగా డ్రిల్లింగ్ యంత్రాలు ...
- Indore
- భారత దేశం
supplyautonomy.com/spaceagesecuritysystems.in
Spaceage Security Systems Ltd. is an exporter of India Solar Lamps products. With a well management system, Sisale strives to offer the best quality products and service as possible as we can, as... మరింత చదవండి »
- టెలిఫోన్ సెట్లు | టెలికమ్యూనికేషన్స్ - పరికరాలు మరియు వ్యవస్థలు | ఎలక్ట్రానిక్ భాగాలు | ఎలక్ట్రానిక్ సరఫరా | విద్యుత్ భా...
- Delhi
- భారత దేశం
supplyautonomy.com/uniquecombustion.in
Company Brief Empowered with technological expertise and service support of a highly skilled workforce, we, Unique Combustion, have emerged as one of the leading manufacturers, exporters, importers,... మరింత చదవండి »
- వ్యాపారం ప్రయాణ ప్యాకేజెస | బాయిలర్ భాగాలు | బర్నర్స్, పారిశ్రామిక | ఎలక్ట్రిక్ మోటార్ | విద్యుత్ మరియు ఎలక్ట్రానిక్ పరి...
- New Delhi
- భారత దేశం
supplyautonomy.com/trademaxenterprise.in
TradeMax Enterprise has been founded by a team of professionals with rich experience in international business and Trading. Our team has worked for years in sourcing of products and... మరింత చదవండి »
- తివాచీలు | కేబుల్ గ్రంధి | ఎలక్ట్రిక్ మోటార్ | ప్యాకేజింగ్ యంత్రాలు | బట్టలు | కొబ్బరి పీచు ఉత్పత్తులు | రబ్బర్ & రబ్బరు...
- Mumbai
- భారత దేశం
supplyautonomy.com/ganpatielectricalspvt.in
Profile
Established in the year 1998, Ganpati Electricals Pvt. Ltd. is amongst the leading manufacturers and traders of wide range of electrical equipment. We specialize in Servo Voltage... మరింత చదవండి »
- విద్యుత్ ఉత్పత్తి మరియు పంపిణీ పరిశ్రమకు కాంట్రాక్టర్లు | ఇతర రూపకల్పన సేవలు | టెర్మినల్ బ్లాక్లను | డీజిల్ జనరేటర్లు | ...
- Delhi
- భారత దేశం
supplyautonomy.com/crystalhomeappliancesindia.in
Ask it and you have it with CRYSTAL HOME APPLIANCES (INDIA) presenting a wide range of MLM products with guaranteed best price. We are one of the biggest names engaged in the domain of offering ... మరింత చదవండి »
- సాఫ్ట్వేర్ అభివృద్ధి సేవలు | పరికరాలు క్లీనింగ్ | మద్యపానయేతరమైనవి | బట్టలు | పర్సులు | విద్యుత్ మరియు ఎలక్ట్రానిక్ ఉత్...
- Jaipur
- భారత దేశం
supplyautonomy.com/acmeinternational1.in
Established in 2003. Acme international is an exporters of machinery equipments for jewellery industries. We always strive to bring the latest and the best, keeping pace with
Technology, time and... మరింత చదవండి »
- ఎయిర్ కర్టన్లు | ప్లాస్టిక్ ఉత్పత్తులు | విద్యుత్ మరియు ఎలక్ట్రానిక్ ఉత్పత్తులు | ఆభరణాల కోసం ఫర్నేస్ | ఆభరణాల కోసం రోలి...
- Mumbai
- భారత దేశం
supplyautonomy.com/srisaienterprises.in
EXPORT PACKERS in Gujarat
QUALITY PACKERS/vinyl packers/anti corrosive packaging
DISTRIBUTOR OF Valvoline Cummins ltd. Tectyl products.
Industrial lubricants distributors
Polka dotted hand... మరింత చదవండి »
- విద్యుత్ ఉత్పత్తి మరియు పంపిణీ పరిశ్రమకు కాంట్రాక్టర్లు | కొరియర్ సేవలు | బాల్ కవాటాలు | సీతాకోకచిలుక కవాటాలు | సాక్స్ మ...
- Warangal
- భారత దేశం
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... మరింత చదవండి »
- సౌర శక్తి ఉత్పత్తి | సౌర శక్తి కన్సల్టెంట్స్ | లిథియం నిల్వ చేసే పరికరాలు | సౌర ఉత్పత్తులు & పరికరాలు | సౌరశక్తి పరికరాల...
- Gurgaon
- భారత దేశం
supplyautonomy.com/zenithfilms.sg
At Zenith Window Films, we offer a spectrum of of 3m solar window films, 3m whiteboard films for home and window tinting in Singapore at cheap prices. We are dedicated to offer excellent service to... మరింత చదవండి »
- సౌర ఉత్పత్తులు & పరికరాలు
- singapore
- సింగపూర్