Axtarış nəticələri: Ambalaj makineleri

Tapılmışdır 7630 şirkətlər

Related kateqoriyalar


supplyautonomy.com/gayatriengineers2.in
GAYATRI ENGINEERS, MUMBAI is the only in india manufactures complete range of Fabric Inspection System, under one roof with all world network. Mr. Vinod Panchal, who is the owner of GAYATRI, has a... Ətraflı »
  • Tekstil-kaplama maşın | Qablaşdırma maşın
  • Thane
  • Hindistan
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... Ətraflı »
  • Qida sənayesi tikili və avadanlıqlar NES | Qablaşdırma maşın
  • Baoding
  • Çin
supplyautonomy.com/zhejianguniversalpackingmachineryfactory.cn
Zhejiang Universal Packing Machinery Factory has been specialized in manufacturing professional machinery for producing polypropylene (PP) spunbond non-woven fabrics and SMS composite nonwoven and... Ətraflı »
  • Tikiş maşınları | Qablaşdırma maşın
  • Wenzhou
  • Çin
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... Ətraflı »
  • Digər əczaçılıq maşın | Qablaşdırma maşın
  • Ruian
  • Çin
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are: Pure/Mineral water production lines Carbonated drink production lines; Fruit juice production lines Tea drink production lines Soy milk and protein drink production... Ətraflı »
  • Təmiz su | Qablaşdırma maşın
  • Suzhou
  • Çin
supplyautonomy.com/sunwayinternational.cn
Guangzhou Sunway Industrial Co., Ltd. is specialized in manufacturing packaging machinery and daily chemical machinery, such as: 1. Tube Production Lines 2. Toothpaste Production Lines 3.... Ətraflı »
  • Fitinqlər | Qida sənayesi tikili və avadanlıqlar NES | Konveyerlər | Qablaşdırma maşın
  • Guangzhou
  • Çin
supplyautonomy.com/kunshanfuriprecisionmachineryco.cn
With European technology, we manufacture adhesive tape coating machine, cutting machine, rewinding machine, bopp tape slitting machine, etc.The products have passed ISO 9001:2000 Certification CE... Ətraflı »
  • İnşaatçıların aletleri | Digər geyim maşın | Freze metal Dəzgah | Qablaşdırma maşın
  • Kunshan
  • Çin
supplyautonomy.com/hebeipingancartonpackagingmachineryco.cn
Hebei Pingan Carton Packaging Machinery Co., Ltd. was founded in 1990. We are a large enterprise specialized in manufacturing of the carton packaging machinery. Our company is conveniently located... Ətraflı »
  • Qablaşdırma maşın | Digər qablaşdırma materiallarını
  • Cangzhou
  • Çin
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people. Our... Ətraflı »
  • Qida sənayesi tikili və avadanlıqlar NES | Masalar Lift | Qablaşdırma maşın | Tel
  • Shijiazhuang
  • Çin
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... Ətraflı »
  • Qablaşdırma maşın | Ağac emalı avadanlıqları
  • Guangzhou
  • Çin
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... Ətraflı »
  • Qaynaq avadanlığı | Plastik qaynaq | Qablaşdırma maşın | Yumurta qablar
  • Guangzhou
  • Çin
supplyautonomy.com/earthpolystrappolymersindustries.in
Partner of the earth Polymers Industries field of packing material since the year of 2003. Earth Polymers Industries is a basically sister concert company of Earth Poly Strap based at rajkot which... Ətraflı »
  • Yapıştırıcılar və tape | Qablaşdırma maşın | Digər qablaşdırma materiallarını | Ucaboylu
  • Rajkot
  • Hindistan
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... Ətraflı »
  • Qablaşdırma maşın | Əczaçılıq qablaşdırma maşın | Digər qablaşdırma materiallarını
  • Ahmedabad
  • Hindistan
supplyautonomy.com/automaticsystems.in
Company Outline AUTOMATIC SYSTEMS is dedicated to provide extensive facilities in designing, engineering, inspecting, manufacturing, installation and commissioning, maintenance. Additionally it s... Ətraflı »
  • Tel rəsm və tel çubuk iş maşınları | Qablaşdırma maşın
  • Jalgaon
  • Hindistan
supplyautonomy.com/acmesalecorporation.in
If you are interested in any of our products, you could contact us at 0091-9356001102 ( Mr. Anil Garg ) or 0091-9876577991 ( Mr.Keshav Garg ). Introduction :- Acme Sales Corporation was... Ətraflı »
  • Plastik kesme maşın | Qablaşdırma maşın
  • Amritsar
  • Hindistan
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... Ətraflı »
  • Qablaşdırma və qablaşdırma - maşın və avadanlıqlar | Bidonlar, pails və barel
  • Aylesbury
  • Birləşmiş Krallıq
supplyautonomy.com/shreejipharmatech.in
About Us Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... Ətraflı »
  • Digər tekstil maşın | Qablaşdırma maşın
  • Ahmedabad
  • Hindistan
supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... Ətraflı »
  • Yazıcılar, fotoşəkil | Marker qələmlər | Yapıştırıcılar və tape | Qablaşdırma maşın
  • Kochi
  • Hindistan
supplyautonomy.com/hipackfillmachinespvt.in
Zulfikar Saifi, who laid foundation stone of his company in 1993, now running with the name of Hi-Pack And Fill Machines Pvt. Ltd., with the strong base of more than 200 satisfied customers with... Ətraflı »
  • Qablaşdırma maşın
  • Faridabad
  • Hindistan
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers, First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... Ətraflı »
  • Krujeva maşın | Qablaşdırma maşın
  • Ahmedabad
  • Hindistan
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... Ətraflı »
  • Kapsul maşın doldurulması | Qablaşdırma maşın
  • Mumbai
  • Hindistan
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... Ətraflı »
  • Qablaşdırma maşın | Ucaboylu
  • New Delhi
  • Hindistan
supplyautonomy.com/monarchappliances.in
MONARCH APPLIANCES IS A MARKETING UNIT OF PACKAGING MACHINERY, LEBELING MACHINE PACKAGING MATERIAL SINCE 1990. AFTER GRAND SUCCESS IN MARKETING OF PACKAGING MACHINERY, WE ENTERED INTO... Ətraflı »
  • Yaş maşın edilməsi silmək | Qablaşdırma maşın
  • Rajkot
  • Hindistan
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group! Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... Ətraflı »
  • düyü bag | Qablaşdırma maşın | Ucaboylu
  • Ahmedabad
  • Hindistan
supplyautonomy.com/problend.bg
We offer : -constructing, manufacture, service and innovative production solutions for packaging equipment -constructing, manufacture, service and innovation of non-standard equipment on... Ətraflı »
  • General mexaniki komponentlər fond | Qablaşdırma və qablaşdırma - maşın və avadanlıqlar
  • Shumen
  • Bolqariya
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... Ətraflı »
  • Qablaşdırma və qablaşdırma - maşın və avadanlıqlar | Qablaşdırma maşın
  • Reggiolo
  • İtaliya
supplyautonomy.com/dolzanimpiantisrl.it
Vertical packing machines, by weight / volume, with 4 welds, Doypack, vacuum, multi-track and semi-automatic for the food processing, pastry making, chemicals, pharmaceuticals and mechanical sectors.
  • Qablaşdırma və qablaşdırma - maşın və avadanlıqlar | Yeyinti sənayesi - maşın və avadanlıqlar
  • Galliera Veneta
  • İtaliya
supplyautonomy.com/jiangmenhenbertsewingtechnology.cn
Henbert is a manufactory which specializes in providing professional equipments for waterproof treatment and relates hot air waterproof adhesive tapes. With many years of experience in this field,... Ətraflı »
  • Qablaşdırma maşın | Tikiş maşınları və ləvazimatlar - sənaye
  • Jianghai
  • Çin
supplyautonomy.com/taidragonmachineryco.tw
TAI DRAGON MACHINERY CO., LTD. was establish in 1977, specializing in the manufacture of High-Speed Horizontal Wrapping Machines.The machinery we make is based on the goal of pursuing high quality... Ətraflı »
  • Maşın wrapping və xarici-wrapping | Qablaşdırma maşın
  • Taizhong
  • tayvan
supplyautonomy.com/sicogaz.fr
  • Sərgi stendləri (icarə / icarə) | Sərgi zallarının (icarə / icarə) | Konfrans otaqları (icarə / icarə) | Ticarət Yarmark...
  • Puteaux
  • Fransa