Loading...
Որոնման արդյունքները: Փաթեթավորման մեքենաներ
Գտնվել է X կազմակերպությունԱռնչվող կատեգորիաներ
supplyautonomy.com/gayatriengineers2.in
GAYATRI ENGINEERS, MUMBAI is the only in india manufactures complete range of Fabric Inspection System, under one roof with all world network. Mr. Vinod Panchal, who is the owner of GAYATRI, has a... Կարդալ ավելին »
- Մանածագործական հարդարման սարքեր | Փաթեթավորում մեքենաներ
- Thane
- Հնդկաստան
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... Կարդալ ավելին »
- Սննդի արդյունաբերություն բույսերի եւ սարքավորումներ nes | Փաթեթավորում մեքենաներ...
- Baoding
- Չինաստան
supplyautonomy.com/zhejianguniversalpackingmachineryfactory.cn
Zhejiang Universal Packing Machinery Factory has been specialized in manufacturing professional machinery for producing polypropylene (PP) spunbond non-woven fabrics and SMS composite nonwoven and... Կարդալ ավելին »
- Կարում մեքենաներ | Փաթեթավորում մեքենաներ
- Wenzhou
- Չինաստան
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... Կարդալ ավելին »
- Այլ դեղագործական մեքենաներ | Փաթեթավորում մեքենաներ
- Ruian
- Չինաստան
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are:
Pure/Mineral water production lines
Carbonated drink production lines;
Fruit juice production lines
Tea drink production lines
Soy milk and protein drink production... Կարդալ ավելին »
- Մաքուր ջրի | Փաթեթավորում մեքենաներ
- Suzhou
- Չինաստան
supplyautonomy.com/sunwayinternational.cn
Guangzhou Sunway Industrial Co., Ltd. is specialized in manufacturing packaging machinery and daily chemical machinery, such as:
1. Tube Production Lines
2. Toothpaste Production Lines
3.... Կարդալ ավելին »
- Խողովակների կցամասեր | Սննդի արդյունաբերություն բույսերի եւ սարքավորումներ nes | Փոխակրիչներ | Փաթեթավորում մեքենաներ...
- Guangzhou
- Չինաստան
supplyautonomy.com/kunshanfuriprecisionmachineryco.cn
With European technology, we manufacture adhesive tape coating machine, cutting machine, rewinding machine, bopp tape slitting machine, etc.The products have passed ISO 9001:2000 Certification CE... Կարդալ ավելին »
- Շինարարներ 'գործիքներ | Այլ հագուստի մեքենաներ | Հաստոցներ համար MILLING մետաղի | Փաթեթավորում մեքենաներ...
- Kunshan
- Չինաստան
supplyautonomy.com/hebeipingancartonpackagingmachineryco.cn
Hebei Pingan Carton Packaging Machinery Co., Ltd. was founded in 1990. We are a large enterprise specialized in manufacturing of the carton packaging machinery. Our company is conveniently located... Կարդալ ավելին »
- Փաթեթավորում մեքենաներ | Այլ փաթեթավորման նյութերը
- Cangzhou
- Չինաստան
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people.
Our... Կարդալ ավելին »
- Սննդի արդյունաբերություն բույսերի եւ սարքավորումներ nes | Բարձրացրեք սեղաններ | Փաթեթավորում մեքենաներ | Staples, մետաղա...
- Shijiazhuang
- Չինաստան
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... Կարդալ ավելին »
- Փաթեթավորում մեքենաներ | Փայտամշակման սարքավորանք
- Guangzhou
- Չինաստան
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... Կարդալ ավելին »
- Եռակցման սարքավորումներ | Պլաստիկ WELDERS | Փաթեթավորում մեքենաներ | Ձվի trays...
- Guangzhou
- Չինաստան
supplyautonomy.com/earthpolystrappolymersindustries.in
Partner of the earth Polymers Industries field of packing material since the year of 2003. Earth Polymers Industries is a basically sister concert company of Earth Poly Strap based at rajkot which... Կարդալ ավելին »
- Սոսինձներ եւ ժապավեն | Փաթեթավորում մեքենաներ | Այլ փաթեթավորման նյութերը | Բարձրահասակ...
- Rajkot
- Հնդկաստան
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... Կարդալ ավելին »
- Փաթեթավորում մեքենաներ | Դեղագործական փաթեթավորման մեքենա | Այլ փաթեթավորման նյութերը...
- Ahmedabad
- Հնդկաստան
supplyautonomy.com/automaticsystems.in
Company Outline
AUTOMATIC SYSTEMS is dedicated to provide extensive facilities in designing, engineering, inspecting, manufacturing, installation and commissioning, maintenance. Additionally it s... Կարդալ ավելին »
- Մետաղական drawing եւ մետաղալար գավազանով աշխատանքային մեքենաներ | Փաթեթավորում մեքենաներ...
- Jalgaon
- Հնդկաստան
supplyautonomy.com/acmesalecorporation.in
If you are interested in any of our products, you could contact us at 0091-9356001102 ( Mr. Anil Garg ) or 0091-9876577991 ( Mr.Keshav Garg ).
Introduction :-
Acme Sales Corporation was... Կարդալ ավելին »
- Պլաստիկ կտրում մեքենաներ | Փաթեթավորում մեքենաներ
- Amritsar
- Հնդկաստան
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... Կարդալ ավելին »
- Փաթեթավորում եւ փաթեթավորում - մեքենաներ եւ սարքավորումներ | Հարվածային գործիքներ, pails եւ բարել...
- Aylesbury
- Մեծ Բրիտանիա
supplyautonomy.com/shreejipharmatech.in
About Us
Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... Կարդալ ավելին »
- Այլ տեքստիլ մեքենաներ | Փաթեթավորում մեքենաներ
- Ahmedabad
- Հնդկաստան
supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... Կարդալ ավելին »
- Տպիչներ, նկարը | Մարկեր գրիչներ | Սոսինձներ եւ ժապավեն | Փաթեթավորում մեքենաներ...
- Kochi
- Հնդկաստան
supplyautonomy.com/hipackfillmachinespvt.in
Zulfikar Saifi, who laid foundation stone of his company in 1993, now running with the name of Hi-Pack And Fill Machines Pvt. Ltd., with the strong base of more than 200 satisfied customers with... Կարդալ ավելին »
- Փաթեթավորում մեքենաներ
- Faridabad
- Հնդկաստան
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers,
First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... Կարդալ ավելին »
- Lace մեքենաներ | Փաթեթավորում մեքենաներ
- Ahmedabad
- Հնդկաստան
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... Կարդալ ավելին »
- Պարկուճ լրացնելով մեքենան | Փաթեթավորում մեքենաներ
- Mumbai
- Հնդկաստան
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... Կարդալ ավելին »
- Փաթեթավորում մեքենաներ | Բարձրահասակ
- New Delhi
- Հնդկաստան
supplyautonomy.com/monarchappliances.in
MONARCH APPLIANCES IS A MARKETING UNIT OF PACKAGING MACHINERY, LEBELING MACHINE PACKAGING MATERIAL SINCE 1990.
AFTER GRAND SUCCESS IN MARKETING OF PACKAGING MACHINERY, WE ENTERED INTO... Կարդալ ավելին »
- Խոնավ սրբել կատարելու մեքենաներ | Փաթեթավորում մեքենաներ
- Rajkot
- Հնդկաստան
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group!
Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... Կարդալ ավելին »
- Ռայսը պայուսակ | Փաթեթավորում մեքենաներ | Բարձրահասակ
- Ahmedabad
- Հնդկաստան
supplyautonomy.com/problend.bg
We offer :
-constructing, manufacture, service and innovative production solutions for packaging equipment
-constructing, manufacture, service and innovation of non-standard equipment on... Կարդալ ավելին »
- General մեխանիկական բաղադրիչներ ֆոնդային | Փաթեթավորում եւ փաթեթավորում - մեքենաներ եւ սարքավորումներ...
- Shumen
- Բուլղարիա
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... Կարդալ ավելին »
- Փաթեթավորում եւ փաթեթավորում - մեքենաներ եւ սարքավորումներ | Փաթեթավորում մեքենաներ...
- Reggiolo
- Իտալիա
supplyautonomy.com/dolzanimpiantisrl.it
Vertical packing machines, by weight / volume, with 4 welds, Doypack, vacuum, multi-track and semi-automatic for the food processing, pastry making, chemicals, pharmaceuticals and mechanical sectors.
- Փաթեթավորում եւ փաթեթավորում - մեքենաներ եւ սարքավորումներ | Սննդի արդյունաբերության, մեքենաներ եւ սարքավորումներ...
- Galliera Veneta
- Իտալիա
supplyautonomy.com/jiangmenhenbertsewingtechnology.cn
Henbert is a manufactory which specializes in providing professional equipments for waterproof treatment and relates hot air waterproof adhesive tapes. With many years of experience in this field,... Կարդալ ավելին »
- Փաթեթավորում մեքենաներ | Կարի մեքենաներ եւ պարագաներ - արդյունաբերական...
- Jianghai
- Չինաստան
supplyautonomy.com/taidragonmachineryco.tw
TAI DRAGON MACHINERY CO., LTD. was establish in 1977, specializing in the manufacture of High-Speed Horizontal Wrapping Machines.The machinery we make is based on the goal of pursuing high quality... Կարդալ ավելին »
- Եզրափակիչ եւ արտաքին, Կշռածրարման մեքենաներ | Փաթեթավորում մեքենաներ...
- Taizhong
- Թայվան