Loading...
தேடல் முடிவுகள்: சிப்பமிடுதல் இயந்திரங்கள்
காணப்படும் 7630 நிறுவனங்கள்தொடர்புடைய பிரிவுகள்
supplyautonomy.com/gayatriengineers2.in
GAYATRI ENGINEERS, MUMBAI is the only in india manufactures complete range of Fabric Inspection System, under one roof with all world network. Mr. Vinod Panchal, who is the owner of GAYATRI, has a... மேலும் வாசிக்க »
- ஜவுளி-முடித்திருக்கிறார்கள் இயந்திரங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
- Thane
- இந்தியா
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... மேலும் வாசிக்க »
- உணவு துறை ஆலை மற்றும் உபகரணங்கள் NES | பேக்கேஜிங் இயந்திரங்கள்...
- Baoding
- சீனா
supplyautonomy.com/zhejianguniversalpackingmachineryfactory.cn
Zhejiang Universal Packing Machinery Factory has been specialized in manufacturing professional machinery for producing polypropylene (PP) spunbond non-woven fabrics and SMS composite nonwoven and... மேலும் வாசிக்க »
- தையல் இயந்திரங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
- Wenzhou
- சீனா
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... மேலும் வாசிக்க »
- மற்ற மருந்து இயந்திரங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
- Ruian
- சீனா
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are:
Pure/Mineral water production lines
Carbonated drink production lines;
Fruit juice production lines
Tea drink production lines
Soy milk and protein drink production... மேலும் வாசிக்க »
- தூய நீர் | பேக்கேஜிங் இயந்திரங்கள்
- Suzhou
- சீனா
supplyautonomy.com/sunwayinternational.cn
Guangzhou Sunway Industrial Co., Ltd. is specialized in manufacturing packaging machinery and daily chemical machinery, such as:
1. Tube Production Lines
2. Toothpaste Production Lines
3.... மேலும் வாசிக்க »
- குழாய் பொருத்துதல்கள் | உணவு துறை ஆலை மற்றும் உபகரணங்கள் NES | கன்வேயர்களாக | பேக்கேஜிங் இயந்திரங்கள்...
- Guangzhou
- சீனா
supplyautonomy.com/kunshanfuriprecisionmachineryco.cn
With European technology, we manufacture adhesive tape coating machine, cutting machine, rewinding machine, bopp tape slitting machine, etc.The products have passed ISO 9001:2000 Certification CE... மேலும் வாசிக்க »
- அடுக்கு மாடி 'கருவிகள் | மற்ற ஆடைகள் இயந்திரங்கள் | அரைக்கும் உலோக இயந்திர கருவிகள் | பேக்கேஜிங் இயந்திரங்கள்...
- Kunshan
- சீனா
supplyautonomy.com/hebeipingancartonpackagingmachineryco.cn
Hebei Pingan Carton Packaging Machinery Co., Ltd. was founded in 1990. We are a large enterprise specialized in manufacturing of the carton packaging machinery. Our company is conveniently located... மேலும் வாசிக்க »
- பேக்கேஜிங் இயந்திரங்கள் | பிற பேக்கேஜிங் பொருட்கள்...
- Cangzhou
- சீனா
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people.
Our... மேலும் வாசிக்க »
- உணவு துறை ஆலை மற்றும் உபகரணங்கள் NES | அட்டவணைகள் உயர்த்தி | பேக்கேஜிங் இயந்திரங்கள் | ஸ்டேபிள்ஸ், கம்பி...
- Shijiazhuang
- சீனா
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... மேலும் வாசிக்க »
- பேக்கேஜிங் இயந்திரங்கள் | மரப்பொருட்கள் உபகரணங்கள்...
- Guangzhou
- சீனா
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... மேலும் வாசிக்க »
- வெல்டிங் உபகரணங்கள் | பிளாஸ்டிக் பற்றவைப்பவர்களில் | பேக்கேஜிங் இயந்திரங்கள் | முட்டை தட்டுக்களில்...
- Guangzhou
- சீனா
supplyautonomy.com/earthpolystrappolymersindustries.in
Partner of the earth Polymers Industries field of packing material since the year of 2003. Earth Polymers Industries is a basically sister concert company of Earth Poly Strap based at rajkot which... மேலும் வாசிக்க »
- ஒட்டிகள் மற்றும் நாடா | பேக்கேஜிங் இயந்திரங்கள் | பிற பேக்கேஜிங் பொருட்கள் | Strapping...
- Rajkot
- இந்தியா
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... மேலும் வாசிக்க »
- பேக்கேஜிங் இயந்திரங்கள் | மருந்து பேக்கேஜிங் இயந்திரம் | பிற பேக்கேஜிங் பொருட்கள்...
- Ahmedabad
- இந்தியா
supplyautonomy.com/automaticsystems.in
Company Outline
AUTOMATIC SYSTEMS is dedicated to provide extensive facilities in designing, engineering, inspecting, manufacturing, installation and commissioning, maintenance. Additionally it s... மேலும் வாசிக்க »
- இழுவைக்கம்பி மற்றும் கம்பி கம்பி தொழிலாள இயந்திரங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
- Jalgaon
- இந்தியா
supplyautonomy.com/acmesalecorporation.in
If you are interested in any of our products, you could contact us at 0091-9356001102 ( Mr. Anil Garg ) or 0091-9876577991 ( Mr.Keshav Garg ).
Introduction :-
Acme Sales Corporation was... மேலும் வாசிக்க »
- பிளாஸ்டிக் குறைப்பு இயந்திரங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
- Amritsar
- இந்தியா
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... மேலும் வாசிக்க »
- பேக்கிங் மற்றும் பேக்கேஜிங் - இயந்திரங்கள் மற்றும் உபகரணங்கள் | டிரம்ஸ், pails மற்றும் பீப்பாய்கள்...
- Aylesbury
- பிரிடிஷ் கூட்டரசு
supplyautonomy.com/shreejipharmatech.in
About Us
Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... மேலும் வாசிக்க »
- மற்ற ஜவுளி இயந்திரங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
- Ahmedabad
- இந்தியா
supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... மேலும் வாசிக்க »
- பிரிண்டர்கள், புகைப்படம் | மார்க்கர் பேனா | ஒட்டிகள் மற்றும் நாடா | பேக்கேஜிங் இயந்திரங்கள்...
- Kochi
- இந்தியா
supplyautonomy.com/hipackfillmachinespvt.in
Zulfikar Saifi, who laid foundation stone of his company in 1993, now running with the name of Hi-Pack And Fill Machines Pvt. Ltd., with the strong base of more than 200 satisfied customers with... மேலும் வாசிக்க »
- பேக்கேஜிங் இயந்திரங்கள்
- Faridabad
- இந்தியா
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers,
First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... மேலும் வாசிக்க »
- சரிகை இயந்திரங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
- Ahmedabad
- இந்தியா
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... மேலும் வாசிக்க »
- காப்ஸ்யூல் இயந்திரம் பூர்த்தி | பேக்கேஜிங் இயந்திரங்கள்...
- Mumbai
- இந்தியா
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... மேலும் வாசிக்க »
- பேக்கேஜிங் இயந்திரங்கள் | Strapping
- New Delhi
- இந்தியா
supplyautonomy.com/monarchappliances.in
MONARCH APPLIANCES IS A MARKETING UNIT OF PACKAGING MACHINERY, LEBELING MACHINE PACKAGING MATERIAL SINCE 1990.
AFTER GRAND SUCCESS IN MARKETING OF PACKAGING MACHINERY, WE ENTERED INTO... மேலும் வாசிக்க »
- ஈரமான இயந்திரங்கள் செய்யும் துடைக்க | பேக்கேஜிங் இயந்திரங்கள்...
- Rajkot
- இந்தியா
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group!
Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... மேலும் வாசிக்க »
- அரிசி பை | பேக்கேஜிங் இயந்திரங்கள் | Strapping
- Ahmedabad
- இந்தியா
supplyautonomy.com/problend.bg
We offer :
-constructing, manufacture, service and innovative production solutions for packaging equipment
-constructing, manufacture, service and innovation of non-standard equipment on... மேலும் வாசிக்க »
- பொது இயந்திர பாகங்களை பங்கு | பேக்கிங் மற்றும் பேக்கேஜிங் - இயந்திரங்கள் மற்றும் உபகரணங்கள்...
- Shumen
- பல்கேரியா
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... மேலும் வாசிக்க »
- பேக்கிங் மற்றும் பேக்கேஜிங் - இயந்திரங்கள் மற்றும் உபகரணங்கள் | பேக்கேஜிங் இயந்திரங்கள்...
- Reggiolo
- இத்தாலி
supplyautonomy.com/dolzanimpiantisrl.it
Vertical packing machines, by weight / volume, with 4 welds, Doypack, vacuum, multi-track and semi-automatic for the food processing, pastry making, chemicals, pharmaceuticals and mechanical sectors.
- பேக்கிங் மற்றும் பேக்கேஜிங் - இயந்திரங்கள் மற்றும் உபகரணங்கள் | உணவு துறை - இயந்திரங்கள் மற்றும் உபகரணங்கள்...
- Galliera Veneta
- இத்தாலி
supplyautonomy.com/jiangmenhenbertsewingtechnology.cn
Henbert is a manufactory which specializes in providing professional equipments for waterproof treatment and relates hot air waterproof adhesive tapes. With many years of experience in this field,... மேலும் வாசிக்க »
- பேக்கேஜிங் இயந்திரங்கள் | தையல் இயந்திரங்கள் மற்றும் உபகரணங்கள் - தொழில்துறை...
- Jianghai
- சீனா
supplyautonomy.com/taidragonmachineryco.tw
TAI DRAGON MACHINERY CO., LTD. was establish in 1977, specializing in the manufacture of High-Speed Horizontal Wrapping Machines.The machinery we make is based on the goal of pursuing high quality... மேலும் வாசிக்க »
- இயந்திரங்கள் போர்த்தி மற்றும் வெளிப்புற-போர்த்தி | பேக்கேஜிங் இயந்திரங்கள்...
- Taizhong
- தைவான்