Loading...
Výsledky hledání pro: Balící stroje
Nalezeno 7630 firemSouvisející kategorie
supplyautonomy.com/gayatriengineers2.in
GAYATRI ENGINEERS, MUMBAI is the only in india manufactures complete range of Fabric Inspection System, under one roof with all world network. Mr. Vinod Panchal, who is the owner of GAYATRI, has a... Přečtěte si více »
- Stroje pro konečnou úpravu textilu | Obalovací, balicí stroje
- Thane
- Indie
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... Přečtěte si více »
- Stroje a zařízení pro potravinářský průmysl, nespecifikované | Obalovací, balicí stroje
- Baoding
- Čína
supplyautonomy.com/zhejianguniversalpackingmachineryfactory.cn
Zhejiang Universal Packing Machinery Factory has been specialized in manufacturing professional machinery for producing polypropylene (PP) spunbond non-woven fabrics and SMS composite nonwoven and... Přečtěte si více »
- Šicí stroje | Obalovací, balicí stroje
- Wenzhou
- Čína
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... Přečtěte si více »
- Ostatní farmaceutické stroje | Obalovací, balicí stroje
- Ruian
- Čína
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are:
Pure/Mineral water production lines
Carbonated drink production lines;
Fruit juice production lines
Tea drink production lines
Soy milk and protein drink production... Přečtěte si více »
- Čistá voda | Obalovací, balicí stroje
- Suzhou
- Čína
supplyautonomy.com/sunwayinternational.cn
Guangzhou Sunway Industrial Co., Ltd. is specialized in manufacturing packaging machinery and daily chemical machinery, such as:
1. Tube Production Lines
2. Toothpaste Production Lines
3.... Přečtěte si více »
- Potrubní tvarovky | Stroje a zařízení pro potravinářský průmysl, nespecifikované | Dopravníky | Obalovací, balicí stroje...
- Guangzhou
- Čína
supplyautonomy.com/kunshanfuriprecisionmachineryco.cn
With European technology, we manufacture adhesive tape coating machine, cutting machine, rewinding machine, bopp tape slitting machine, etc.The products have passed ISO 9001:2000 Certification CE... Přečtěte si více »
- Stavební nářadí | Ostatní stroje a zařízení na výrobu oblečení | Obráběcí a tvářecí stroje pro frézování kovů | Obalovac...
- Kunshan
- Čína
supplyautonomy.com/hebeipingancartonpackagingmachineryco.cn
Hebei Pingan Carton Packaging Machinery Co., Ltd. was founded in 1990. We are a large enterprise specialized in manufacturing of the carton packaging machinery. Our company is conveniently located... Přečtěte si více »
- Obalovací, balicí stroje | Ostatní balicí materiály
- Cangzhou
- Čína
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people.
Our... Přečtěte si více »
- Stroje a zařízení pro potravinářský průmysl, nespecifikované | Zvedací stoly | Obalovací, balicí stroje | Drátky do seší...
- Shijiazhuang
- Čína
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... Přečtěte si více »
- Obalovací, balicí stroje | Zařízení na obrábění dřeva
- Guangzhou
- Čína
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... Přečtěte si více »
- Zařízení pro sváření | Plastové svářečky | Obalovací, balicí stroje | Vaječné zásobníky
- Guangzhou
- Čína
supplyautonomy.com/earthpolystrappolymersindustries.in
Partner of the earth Polymers Industries field of packing material since the year of 2003. Earth Polymers Industries is a basically sister concert company of Earth Poly Strap based at rajkot which... Přečtěte si více »
- Lepidla a pásky | Obalovací, balicí stroje | Ostatní balicí materiály | Popruhy
- Rajkot
- Indie
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... Přečtěte si více »
- Obalovací, balicí stroje | Farmaceutické stroje na balení | Ostatní balicí materiály
- Ahmedabad
- Indie
supplyautonomy.com/automaticsystems.in
Company Outline
AUTOMATIC SYSTEMS is dedicated to provide extensive facilities in designing, engineering, inspecting, manufacturing, installation and commissioning, maintenance. Additionally it s... Přečtěte si více »
- Stroje pro tažírny drátů a zpracování kovů v drátech | Obalovací, balicí stroje
- Jalgaon
- Indie
supplyautonomy.com/acmesalecorporation.in
If you are interested in any of our products, you could contact us at 0091-9356001102 ( Mr. Anil Garg ) or 0091-9876577991 ( Mr.Keshav Garg ).
Introduction :-
Acme Sales Corporation was... Přečtěte si více »
- Plastové řezačky | Obalovací, balicí stroje
- Amritsar
- Indie
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... Přečtěte si více »
- Balení a adjustace - stroje a zařízení | Sudy, kbelíky a barely
- Aylesbury
- Velká Británie
supplyautonomy.com/shreejipharmatech.in
About Us
Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... Přečtěte si více »
- Ostatní textilní stroje | Obalovací, balicí stroje
- Ahmedabad
- Indie
supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... Přečtěte si více »
- Tiskárny fotografické | Značkovací pera | Lepidla a pásky | Obalovací, balicí stroje
- Kochi
- Indie
supplyautonomy.com/hipackfillmachinespvt.in
Zulfikar Saifi, who laid foundation stone of his company in 1993, now running with the name of Hi-Pack And Fill Machines Pvt. Ltd., with the strong base of more than 200 satisfied customers with... Přečtěte si více »
- Obalovací, balicí stroje
- Faridabad
- Indie
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers,
First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... Přečtěte si více »
- Stroje na krajky, krajky | Obalovací, balicí stroje
- Ahmedabad
- Indie
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... Přečtěte si více »
- Plničky, plnicí stroje kapslí | Obalovací, balicí stroje
- Mumbai
- Indie
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... Přečtěte si více »
- Obalovací, balicí stroje | Popruhy
- New Delhi
- Indie
supplyautonomy.com/monarchappliances.in
MONARCH APPLIANCES IS A MARKETING UNIT OF PACKAGING MACHINERY, LEBELING MACHINE PACKAGING MATERIAL SINCE 1990.
AFTER GRAND SUCCESS IN MARKETING OF PACKAGING MACHINERY, WE ENTERED INTO... Přečtěte si více »
- Stroje na výrobu vlhčených ubrousků | Obalovací, balicí stroje
- Rajkot
- Indie
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group!
Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... Přečtěte si více »
- Pytel na rýži | Obalovací, balicí stroje | Popruhy
- Ahmedabad
- Indie
supplyautonomy.com/problend.bg
We offer :
-constructing, manufacture, service and innovative production solutions for packaging equipment
-constructing, manufacture, service and innovation of non-standard equipment on... Přečtěte si více »
- Obecné mechanické komponenty, zásoby | Balení a adjustace - stroje a zařízení
- Shumen
- Bulharsko
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... Přečtěte si více »
- Balení a adjustace - stroje a zařízení | Obalovací, balicí stroje
- Reggiolo
- Itálie
supplyautonomy.com/dolzanimpiantisrl.it
Vertical packing machines, by weight / volume, with 4 welds, Doypack, vacuum, multi-track and semi-automatic for the food processing, pastry making, chemicals, pharmaceuticals and mechanical sectors.
- Balení a adjustace - stroje a zařízení | Potravinářský průmysl různé - stroje a zařízení
- Galliera Veneta
- Itálie
supplyautonomy.com/jiangmenhenbertsewingtechnology.cn
Henbert is a manufactory which specializes in providing professional equipments for waterproof treatment and relates hot air waterproof adhesive tapes. With many years of experience in this field,... Přečtěte si více »
- Obalovací, balicí stroje | Šicí stroje a příslušenství, průmyslové
- Jianghai
- Čína
supplyautonomy.com/taidragonmachineryco.tw
TAI DRAGON MACHINERY CO., LTD. was establish in 1977, specializing in the manufacture of High-Speed Horizontal Wrapping Machines.The machinery we make is based on the goal of pursuing high quality... Přečtěte si více »
- Vnitřní a vnější obaly - stroje | Obalovací, balicí stroje
- Taizhong
- Tchaj-wan