Search Results for: Packaging machines
Found 7630 companiesRelated categories
supplyautonomy.com/gayatriengineers2.in
GAYATRI ENGINEERS, MUMBAI is the only in india manufactures complete range of Fabric Inspection System, under one roof with all world network. Mr. Vinod Panchal, who is the owner of GAYATRI, has a... Read More »
- Textile-finishing machinery | Packaging machinery
- Thane
- India
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... Read More »
- Food industry plant and equipment NES | Packaging machinery
- Baoding
- China
supplyautonomy.com/zhejianguniversalpackingmachineryfactory.cn
Zhejiang Universal Packing Machinery Factory has been specialized in manufacturing professional machinery for producing polypropylene (PP) spunbond non-woven fabrics and SMS composite nonwoven and... Read More »
- Sewing machines | Packaging machinery
- Wenzhou
- China
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... Read More »
- Other pharmaceutical machinery | Packaging machinery
- Ruian
- China
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are:
Pure/Mineral water production lines
Carbonated drink production lines;
Fruit juice production lines
Tea drink production lines
Soy milk and protein drink production... Read More »
- Pure water | Packaging machinery
- Suzhou
- China
supplyautonomy.com/sunwayinternational.cn
Guangzhou Sunway Industrial Co., Ltd. is specialized in manufacturing packaging machinery and daily chemical machinery, such as:
1. Tube Production Lines
2. Toothpaste Production Lines
3.... Read More »
- Pipe fittings | Food industry plant and equipment NES | Conveyors | Packaging machinery
- Guangzhou
- China
supplyautonomy.com/kunshanfuriprecisionmachineryco.cn
With European technology, we manufacture adhesive tape coating machine, cutting machine, rewinding machine, bopp tape slitting machine, etc.The products have passed ISO 9001:2000 Certification CE... Read More »
- Builders' tools | Other apparel machinery | Machine tools for milling metal | Packaging machinery
- Kunshan
- China
supplyautonomy.com/hebeipingancartonpackagingmachineryco.cn
Hebei Pingan Carton Packaging Machinery Co., Ltd. was founded in 1990. We are a large enterprise specialized in manufacturing of the carton packaging machinery. Our company is conveniently located... Read More »
- Packaging machinery | Other packaging materials
- Cangzhou
- China
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people.
Our... Read More »
- Food industry plant and equipment NES | Lift tables | Packaging machinery | Staples, wire
- Shijiazhuang
- China
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... Read More »
- Packaging machinery | Woodworking equipment
- Guangzhou
- China
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... Read More »
- Welding equipment | Plastic welders | Packaging machinery | Egg trays
- Guangzhou
- China
supplyautonomy.com/earthpolystrappolymersindustries.in
Partner of the earth Polymers Industries field of packing material since the year of 2003. Earth Polymers Industries is a basically sister concert company of Earth Poly Strap based at rajkot which... Read More »
- Adhesives and tape | Packaging machinery | Other packaging materials | Strapping
- Rajkot
- India
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... Read More »
- Packaging machinery | Pharmaceutical packaging machine | Other packaging materials
- Ahmedabad
- India
supplyautonomy.com/automaticsystems.in
Company Outline
AUTOMATIC SYSTEMS is dedicated to provide extensive facilities in designing, engineering, inspecting, manufacturing, installation and commissioning, maintenance. Additionally it s... Read More »
- Wire drawing and wire rod working machines | Packaging machinery
- Jalgaon
- India
supplyautonomy.com/acmesalecorporation.in
If you are interested in any of our products, you could contact us at 0091-9356001102 ( Mr. Anil Garg ) or 0091-9876577991 ( Mr.Keshav Garg ).
Introduction :-
Acme Sales Corporation was... Read More »
- Plastic cutting machinery | Packaging machinery
- Amritsar
- India
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... Read More »
- Packing and packaging - machinery and equipment | Drums, pails and barrels
- Aylesbury
- United Kingdom
supplyautonomy.com/shreejipharmatech.in
About Us
Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... Read More »
- Other textile machinery | Packaging machinery
- Ahmedabad
- India
supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... Read More »
- Printers, photograph | Marker pens | Adhesives and tape | Packaging machinery
- Kochi
- India
supplyautonomy.com/hipackfillmachinespvt.in
Zulfikar Saifi, who laid foundation stone of his company in 1993, now running with the name of Hi-Pack And Fill Machines Pvt. Ltd., with the strong base of more than 200 satisfied customers with... Read More »
- Packaging machinery
- Faridabad
- India
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers,
First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... Read More »
- Lace machines | Packaging machinery
- Ahmedabad
- India
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... Read More »
- Capsule filling machine | Packaging machinery
- Mumbai
- India
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... Read More »
- Packaging machinery | Strapping
- New Delhi
- India
supplyautonomy.com/monarchappliances.in
MONARCH APPLIANCES IS A MARKETING UNIT OF PACKAGING MACHINERY, LEBELING MACHINE PACKAGING MATERIAL SINCE 1990.
AFTER GRAND SUCCESS IN MARKETING OF PACKAGING MACHINERY, WE ENTERED INTO... Read More »
- Wet wipe making machinery | Packaging machinery
- Rajkot
- India
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group!
Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... Read More »
- Rice bag | Packaging machinery | Strapping
- Ahmedabad
- India
supplyautonomy.com/problend.bg
We offer :
-constructing, manufacture, service and innovative production solutions for packaging equipment
-constructing, manufacture, service and innovation of non-standard equipment on... Read More »
- General mechanical components stock | Packing and packaging - machinery and equipment
- Shumen
- Bulgaria
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... Read More »
- Packing and packaging - machinery and equipment | Packaging machinery
- Reggiolo
- Italy
supplyautonomy.com/dolzanimpiantisrl.it
Vertical packing machines, by weight / volume, with 4 welds, Doypack, vacuum, multi-track and semi-automatic for the food processing, pastry making, chemicals, pharmaceuticals and mechanical sectors.
- Packing and packaging - machinery and equipment | Food industry - machinery and equipment
- Galliera Veneta
- Italy
supplyautonomy.com/jiangmenhenbertsewingtechnology.cn
Henbert is a manufactory which specializes in providing professional equipments for waterproof treatment and relates hot air waterproof adhesive tapes. With many years of experience in this field,... Read More »
- Packaging machinery | Sewing machines and accessories - industrial
- Jianghai
- China
supplyautonomy.com/taidragonmachineryco.tw
TAI DRAGON MACHINERY CO., LTD. was establish in 1977, specializing in the manufacture of High-Speed Horizontal Wrapping Machines.The machinery we make is based on the goal of pursuing high quality... Read More »
- Wrapping and outer-wrapping machinery | Packaging machinery
- Taizhong
- Taiwan