Loading...
Resultados da pesquisa para: Máquinas para empacotar
Empresas 7630 encontradosCategorias relacionadas
supplyautonomy.com/gayatriengineers2.in
GAYATRI ENGINEERS, MUMBAI is the only in india manufactures complete range of Fabric Inspection System, under one roof with all world network. Mr. Vinod Panchal, who is the owner of GAYATRI, has a... Leia mais »
- Máquinas para acabamento de têxteis | Máquinas para embalagens
- Thane
- Índia
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... Leia mais »
- Instalações e equipamentos para a indústria alimentar, não especificados anteriormente | Máquinas para embalagens
- Baoding
- China
supplyautonomy.com/zhejianguniversalpackingmachineryfactory.cn
Zhejiang Universal Packing Machinery Factory has been specialized in manufacturing professional machinery for producing polypropylene (PP) spunbond non-woven fabrics and SMS composite nonwoven and... Leia mais »
- Máquinas de costura | Máquinas para embalagens
- Wenzhou
- China
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... Leia mais »
- Outras máquinas farmacêuticas | Máquinas para embalagens
- Ruian
- China
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are:
Pure/Mineral water production lines
Carbonated drink production lines;
Fruit juice production lines
Tea drink production lines
Soy milk and protein drink production... Leia mais »
- Água pura | Máquinas para embalagens
- Suzhou
- China
supplyautonomy.com/sunwayinternational.cn
Guangzhou Sunway Industrial Co., Ltd. is specialized in manufacturing packaging machinery and daily chemical machinery, such as:
1. Tube Production Lines
2. Toothpaste Production Lines
3.... Leia mais »
- Acessórios para condutas | Instalações e equipamentos para a indústria alimentar, não especificados anteriormente | Apar...
- Guangzhou
- China
supplyautonomy.com/kunshanfuriprecisionmachineryco.cn
With European technology, we manufacture adhesive tape coating machine, cutting machine, rewinding machine, bopp tape slitting machine, etc.The products have passed ISO 9001:2000 Certification CE... Leia mais »
- Ferramentas para construtores | Outras máquinas do fato | Máquinas-ferramentas para fresar metais | Máquinas para em...
- Kunshan
- China
supplyautonomy.com/hebeipingancartonpackagingmachineryco.cn
Hebei Pingan Carton Packaging Machinery Co., Ltd. was founded in 1990. We are a large enterprise specialized in manufacturing of the carton packaging machinery. Our company is conveniently located... Leia mais »
- Máquinas para embalagens | Outros materiais de embalagem
- Cangzhou
- China
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people.
Our... Leia mais »
- Instalações e equipamentos para a indústria alimentar, não especificados anteriormente | Mesas Elevadoras | Máquinas par...
- Shijiazhuang
- China
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... Leia mais »
- Máquinas para embalagens | Equipamento para trabalhar madeira
- Guangzhou
- China
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... Leia mais »
- Equipamento para soldagem | Soldadoras para Plástico | Máquinas para embalagens | Bandejas de Ovo
- Guangzhou
- China
supplyautonomy.com/earthpolystrappolymersindustries.in
Partner of the earth Polymers Industries field of packing material since the year of 2003. Earth Polymers Industries is a basically sister concert company of Earth Poly Strap based at rajkot which... Leia mais »
- Adesivos e fitas | Máquinas para embalagens | Outros materiais de embalagem | Colocação de correias
- Rajkot
- Índia
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... Leia mais »
- Máquinas para embalagens | Máquinas de empacotamento farmacêutico | Outros materiais de embalagem
- Ahmedabad
- Índia
supplyautonomy.com/automaticsystems.in
Company Outline
AUTOMATIC SYSTEMS is dedicated to provide extensive facilities in designing, engineering, inspecting, manufacturing, installation and commissioning, maintenance. Additionally it s... Leia mais »
- Máquinas para trefilaria e trabalho de metais em fio | Máquinas para embalagens
- Jalgaon
- Índia
supplyautonomy.com/acmesalecorporation.in
If you are interested in any of our products, you could contact us at 0091-9356001102 ( Mr. Anil Garg ) or 0091-9876577991 ( Mr.Keshav Garg ).
Introduction :-
Acme Sales Corporation was... Leia mais »
- Máquinas de corte plásticas | Máquinas para embalagens
- Amritsar
- Índia
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... Leia mais »
- Embalagens e acondicionamento - máquinas e material | Tambores, baldes e tonéis
- Aylesbury
- Reino Unido
supplyautonomy.com/shreejipharmatech.in
About Us
Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... Leia mais »
- Outras máquinas de matéria têxtil | Máquinas para embalagens
- Ahmedabad
- Índia
supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... Leia mais »
- Impressoras de fotografia | Marcador | Adesivos e fitas | Máquinas para embalagens
- Kochi
- Índia
supplyautonomy.com/hipackfillmachinespvt.in
Zulfikar Saifi, who laid foundation stone of his company in 1993, now running with the name of Hi-Pack And Fill Machines Pvt. Ltd., with the strong base of more than 200 satisfied customers with... Leia mais »
- Máquinas para embalagens
- Faridabad
- Índia
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers,
First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... Leia mais »
- Máquinas para tornear | Máquinas para embalagens
- Ahmedabad
- Índia
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... Leia mais »
- Máquinas de enchimento da cápsula | Máquinas para embalagens
- Mumbai
- Índia
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... Leia mais »
- Máquinas para embalagens | Colocação de correias
- New Delhi
- Índia
supplyautonomy.com/monarchappliances.in
MONARCH APPLIANCES IS A MARKETING UNIT OF PACKAGING MACHINERY, LEBELING MACHINE PACKAGING MATERIAL SINCE 1990.
AFTER GRAND SUCCESS IN MARKETING OF PACKAGING MACHINERY, WE ENTERED INTO... Leia mais »
- Máquinas de Produção de Guardanapo Molhado | Máquinas para embalagens
- Rajkot
- Índia
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group!
Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... Leia mais »
- Saco para arroz | Máquinas para embalagens | Colocação de correias
- Ahmedabad
- Índia
supplyautonomy.com/problend.bg
We offer :
-constructing, manufacture, service and innovative production solutions for packaging equipment
-constructing, manufacture, service and innovation of non-standard equipment on... Leia mais »
- Estoque de Componentes Mecânicos Gerais | Embalagens e acondicionamento - máquinas e material
- Shumen
- Bulgária
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... Leia mais »
- Embalagens e acondicionamento - máquinas e material | Máquinas para embalagens
- Reggiolo
- Itália
supplyautonomy.com/dolzanimpiantisrl.it
Vertical packing machines, by weight / volume, with 4 welds, Doypack, vacuum, multi-track and semi-automatic for the food processing, pastry making, chemicals, pharmaceuticals and mechanical sectors.
- Embalagens e acondicionamento - máquinas e material | Indústria alimentar - máquinas e material
- Galliera Veneta
- Itália
supplyautonomy.com/jiangmenhenbertsewingtechnology.cn
Henbert is a manufactory which specializes in providing professional equipments for waterproof treatment and relates hot air waterproof adhesive tapes. With many years of experience in this field,... Leia mais »
- Máquinas para embalagens | Máquinas de coser industriais e acessórios
- Jianghai
- China
supplyautonomy.com/taidragonmachineryco.tw
TAI DRAGON MACHINERY CO., LTD. was establish in 1977, specializing in the manufacture of High-Speed Horizontal Wrapping Machines.The machinery we make is based on the goal of pursuing high quality... Leia mais »
- Máquinas de embalagem e embalagem exterior | Máquinas para embalagens
- Taizhong
- Taiwan