Search Results for: Mesin pembungkusan
Syarikat 7630 DijumpaiKategori berkaitan
supplyautonomy.com/gayatriengineers2.in
GAYATRI ENGINEERS, MUMBAI is the only in india manufactures complete range of Fabric Inspection System, under one roof with all world network. Mr. Vinod Panchal, who is the owner of GAYATRI, has a... Read More »
- Jentera tekstil finishing | Jentera pembungkusan
- Thane
- India
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... Read More »
- Kilang industri makanan dan peralatan tstl | Jentera pembungkusan
- Baoding
- China
supplyautonomy.com/zhejianguniversalpackingmachineryfactory.cn
Zhejiang Universal Packing Machinery Factory has been specialized in manufacturing professional machinery for producing polypropylene (PP) spunbond non-woven fabrics and SMS composite nonwoven and... Read More »
- Mesin jahit | Jentera pembungkusan
- Wenzhou
- China
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... Read More »
- Jentera farmaseutikal | Jentera pembungkusan
- Ruian
- China
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are:
Pure/Mineral water production lines
Carbonated drink production lines;
Fruit juice production lines
Tea drink production lines
Soy milk and protein drink production... Read More »
- Air tulen | Jentera pembungkusan
- Suzhou
- China
supplyautonomy.com/sunwayinternational.cn
Guangzhou Sunway Industrial Co., Ltd. is specialized in manufacturing packaging machinery and daily chemical machinery, such as:
1. Tube Production Lines
2. Toothpaste Production Lines
3.... Read More »
- Kelengkapan paip | Kilang industri makanan dan peralatan tstl | Penghantar | Jentera pembungkusan
- Guangzhou
- China
supplyautonomy.com/kunshanfuriprecisionmachineryco.cn
With European technology, we manufacture adhesive tape coating machine, cutting machine, rewinding machine, bopp tape slitting machine, etc.The products have passed ISO 9001:2000 Certification CE... Read More »
- Alat pembina ' | Jentera pakaian lain | Alat mesin untuk logam pengilangan | Jentera pembungkusan
- Kunshan
- China
supplyautonomy.com/hebeipingancartonpackagingmachineryco.cn
Hebei Pingan Carton Packaging Machinery Co., Ltd. was founded in 1990. We are a large enterprise specialized in manufacturing of the carton packaging machinery. Our company is conveniently located... Read More »
- Jentera pembungkusan | Bahan-bahan pembungkusan lain
- Cangzhou
- China
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people.
Our... Read More »
- Kilang industri makanan dan peralatan tstl | Angkat meja | Jentera pembungkusan | Staples, wayar
- Shijiazhuang
- China
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... Read More »
- Jentera pembungkusan | Peralatan kerja kayu
- Guangzhou
- China
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... Read More »
- Peralatan kimpalan | Pengimpal plastik | Jentera pembungkusan | Dulang telur
- Guangzhou
- China
supplyautonomy.com/earthpolystrappolymersindustries.in
Partner of the earth Polymers Industries field of packing material since the year of 2003. Earth Polymers Industries is a basically sister concert company of Earth Poly Strap based at rajkot which... Read More »
- Pelekat dan pita | Jentera pembungkusan | Bahan-bahan pembungkusan lain | Tegap
- Rajkot
- India
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... Read More »
- Jentera pembungkusan | Mesin pembungkusan farmaseutikal | Bahan-bahan pembungkusan lain
- Ahmedabad
- India
supplyautonomy.com/automaticsystems.in
Company Outline
AUTOMATIC SYSTEMS is dedicated to provide extensive facilities in designing, engineering, inspecting, manufacturing, installation and commissioning, maintenance. Additionally it s... Read More »
- Lukisan wayar dan dawai rod mesin kerja | Jentera pembungkusan
- Jalgaon
- India
supplyautonomy.com/acmesalecorporation.in
If you are interested in any of our products, you could contact us at 0091-9356001102 ( Mr. Anil Garg ) or 0091-9876577991 ( Mr.Keshav Garg ).
Introduction :-
Acme Sales Corporation was... Read More »
- Jentera memotong plastik | Jentera pembungkusan
- Amritsar
- India
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... Read More »
- Pembungkusan dan pembungkusan - mesin dan peralatan | Gendang, baldi dan tong
- Aylesbury
- United Kingdom
supplyautonomy.com/shreejipharmatech.in
About Us
Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... Read More »
- Jentera tekstil lain | Jentera pembungkusan
- Ahmedabad
- India
supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... Read More »
- Pencetak, gambar | Pen Marker | Pelekat dan pita | Jentera pembungkusan
- Kochi
- India
supplyautonomy.com/hipackfillmachinespvt.in
Zulfikar Saifi, who laid foundation stone of his company in 1993, now running with the name of Hi-Pack And Fill Machines Pvt. Ltd., with the strong base of more than 200 satisfied customers with... Read More »
- Jentera pembungkusan
- Faridabad
- India
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers,
First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... Read More »
- Mesin Lace | Jentera pembungkusan
- Ahmedabad
- India
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... Read More »
- Kapsul mengisi mesin | Jentera pembungkusan
- Mumbai
- India
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... Read More »
- Jentera pembungkusan | Tegap
- New Delhi
- India
supplyautonomy.com/monarchappliances.in
MONARCH APPLIANCES IS A MARKETING UNIT OF PACKAGING MACHINERY, LEBELING MACHINE PACKAGING MATERIAL SINCE 1990.
AFTER GRAND SUCCESS IN MARKETING OF PACKAGING MACHINERY, WE ENTERED INTO... Read More »
- Basah lap membuat jentera | Jentera pembungkusan
- Rajkot
- India
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group!
Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... Read More »
- Beg beras | Jentera pembungkusan | Tegap
- Ahmedabad
- India
supplyautonomy.com/problend.bg
We offer :
-constructing, manufacture, service and innovative production solutions for packaging equipment
-constructing, manufacture, service and innovation of non-standard equipment on... Read More »
- Mekanikal am saham komponen | Pembungkusan dan pembungkusan - mesin dan peralatan
- Shumen
- Bulgaria
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... Read More »
- Pembungkusan dan pembungkusan - mesin dan peralatan | Jentera pembungkusan
- Reggiolo
- Itali
supplyautonomy.com/dolzanimpiantisrl.it
Vertical packing machines, by weight / volume, with 4 welds, Doypack, vacuum, multi-track and semi-automatic for the food processing, pastry making, chemicals, pharmaceuticals and mechanical sectors.
- Pembungkusan dan pembungkusan - mesin dan peralatan | Industri makanan - mesin dan peralatan
- Galliera Veneta
- Itali
supplyautonomy.com/jiangmenhenbertsewingtechnology.cn
Henbert is a manufactory which specializes in providing professional equipments for waterproof treatment and relates hot air waterproof adhesive tapes. With many years of experience in this field,... Read More »
- Jentera pembungkusan | Mesin jahit dan aksesori - industri
- Jianghai
- China
supplyautonomy.com/taidragonmachineryco.tw
TAI DRAGON MACHINERY CO., LTD. was establish in 1977, specializing in the manufacture of High-Speed Horizontal Wrapping Machines.The machinery we make is based on the goal of pursuing high quality... Read More »
- Membungkus dan luar-membungkus jentera | Jentera pembungkusan
- Taizhong
- Taiwan