کے لئے تلاش کے نتائج: پیکجنگ مشینیں
ملا 7630 کمپنیوںمتعلقہ زمرے
supplyautonomy.com/gayatriengineers2.in
GAYATRI ENGINEERS, MUMBAI is the only in india manufactures complete range of Fabric Inspection System, under one roof with all world network. Mr. Vinod Panchal, who is the owner of GAYATRI, has a... مزید پڑھیں »
- ٹیکسٹائل-مکمل کرنے کی مشینری | پیکجنگ مشینری
- Thane
- بھارت
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... مزید پڑھیں »
- کھانے کی صنعت کے پلانٹ اور سامان NES | پیکجنگ مشینری
- Baoding
- چین
supplyautonomy.com/zhejianguniversalpackingmachineryfactory.cn
Zhejiang Universal Packing Machinery Factory has been specialized in manufacturing professional machinery for producing polypropylene (PP) spunbond non-woven fabrics and SMS composite nonwoven and... مزید پڑھیں »
- سلائی مشینیں | پیکجنگ مشینری
- Wenzhou
- چین
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... مزید پڑھیں »
- دیگر دواسازی کی مشینری | پیکجنگ مشینری
- Ruian
- چین
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are:
Pure/Mineral water production lines
Carbonated drink production lines;
Fruit juice production lines
Tea drink production lines
Soy milk and protein drink production... مزید پڑھیں »
- آپکی پانی | پیکجنگ مشینری
- Suzhou
- چین
supplyautonomy.com/sunwayinternational.cn
Guangzhou Sunway Industrial Co., Ltd. is specialized in manufacturing packaging machinery and daily chemical machinery, such as:
1. Tube Production Lines
2. Toothpaste Production Lines
3.... مزید پڑھیں »
- پائپ کی متعلقہ اشیاء | کھانے کی صنعت کے پلانٹ اور سامان NES | کنویرز | پیکجنگ مشینری...
- Guangzhou
- چین
supplyautonomy.com/kunshanfuriprecisionmachineryco.cn
With European technology, we manufacture adhesive tape coating machine, cutting machine, rewinding machine, bopp tape slitting machine, etc.The products have passed ISO 9001:2000 Certification CE... مزید پڑھیں »
- معماروں، فورم کے اوزار | دیگر ملبوسات مشینری | گھسائی کرنے والی دھات کے لئے مشینی اوزار | پیکجنگ مشینری...
- Kunshan
- چین
supplyautonomy.com/hebeipingancartonpackagingmachineryco.cn
Hebei Pingan Carton Packaging Machinery Co., Ltd. was founded in 1990. We are a large enterprise specialized in manufacturing of the carton packaging machinery. Our company is conveniently located... مزید پڑھیں »
- پیکجنگ مشینری | دیگر پیکیجنگ مواد
- Cangzhou
- چین
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people.
Our... مزید پڑھیں »
- کھانے کی صنعت کے پلانٹ اور سامان NES | میزیں اٹھاو | پیکجنگ مشینری | اسٹیپلز، تار...
- Shijiazhuang
- چین
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... مزید پڑھیں »
- پیکجنگ مشینری | Woodworking سامان
- Guangzhou
- چین
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... مزید پڑھیں »
- ویلڈنگ کا سامان | پلاسٹک ویلڈر | پیکجنگ مشینری | انڈے ٹرے
- Guangzhou
- چین
supplyautonomy.com/earthpolystrappolymersindustries.in
Partner of the earth Polymers Industries field of packing material since the year of 2003. Earth Polymers Industries is a basically sister concert company of Earth Poly Strap based at rajkot which... مزید پڑھیں »
- Adhesives اور ٹیپ | پیکجنگ مشینری | دیگر پیکیجنگ مواد | Strapping کے
- Rajkot
- بھارت
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... مزید پڑھیں »
- پیکجنگ مشینری | دواسازی کی پیکنگ مشین | دیگر پیکیجنگ مواد
- Ahmedabad
- بھارت
supplyautonomy.com/automaticsystems.in
Company Outline
AUTOMATIC SYSTEMS is dedicated to provide extensive facilities in designing, engineering, inspecting, manufacturing, installation and commissioning, maintenance. Additionally it s... مزید پڑھیں »
- وائر ڈرائنگ اور وائر راڈ کام کرنے کی مشینیں | پیکجنگ مشینری
- Jalgaon
- بھارت
supplyautonomy.com/acmesalecorporation.in
If you are interested in any of our products, you could contact us at 0091-9356001102 ( Mr. Anil Garg ) or 0091-9876577991 ( Mr.Keshav Garg ).
Introduction :-
Acme Sales Corporation was... مزید پڑھیں »
- پلاسٹک کاٹنے کی مشینری | پیکجنگ مشینری
- Amritsar
- بھارت
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... مزید پڑھیں »
- پیکنگ اور پیکجنگ - مشینری اور سامان | ڈرم، pails اور بیرل
- Aylesbury
- سلطنت متحدہ
supplyautonomy.com/shreejipharmatech.in
About Us
Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... مزید پڑھیں »
- دیگر ٹیکسٹائل مشینری | پیکجنگ مشینری
- Ahmedabad
- بھارت
supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... مزید پڑھیں »
- پرنٹرز، تصویر | مارکر قلم | Adhesives اور ٹیپ | پیکجنگ مشینری
- Kochi
- بھارت
supplyautonomy.com/hipackfillmachinespvt.in
Zulfikar Saifi, who laid foundation stone of his company in 1993, now running with the name of Hi-Pack And Fill Machines Pvt. Ltd., with the strong base of more than 200 satisfied customers with... مزید پڑھیں »
- پیکجنگ مشینری
- Faridabad
- بھارت
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers,
First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... مزید پڑھیں »
- لیس مشینیں | پیکجنگ مشینری
- Ahmedabad
- بھارت
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... مزید پڑھیں »
- کیپسول مشین بھرنے | پیکجنگ مشینری
- Mumbai
- بھارت
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... مزید پڑھیں »
- پیکجنگ مشینری | Strapping کے
- New Delhi
- بھارت
supplyautonomy.com/monarchappliances.in
MONARCH APPLIANCES IS A MARKETING UNIT OF PACKAGING MACHINERY, LEBELING MACHINE PACKAGING MATERIAL SINCE 1990.
AFTER GRAND SUCCESS IN MARKETING OF PACKAGING MACHINERY, WE ENTERED INTO... مزید پڑھیں »
- گیلے مشینری بنانے مسح | پیکجنگ مشینری
- Rajkot
- بھارت
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group!
Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... مزید پڑھیں »
- رائس بیگ | پیکجنگ مشینری | Strapping کے
- Ahmedabad
- بھارت
supplyautonomy.com/problend.bg
We offer :
-constructing, manufacture, service and innovative production solutions for packaging equipment
-constructing, manufacture, service and innovation of non-standard equipment on... مزید پڑھیں »
- جنرل میکانی اجزاء اسٹاک | پیکنگ اور پیکجنگ - مشینری اور سامان
- Shumen
- بلغاریہ
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... مزید پڑھیں »
- پیکنگ اور پیکجنگ - مشینری اور سامان | پیکجنگ مشینری
- Reggiolo
- اٹلی
supplyautonomy.com/dolzanimpiantisrl.it
supplyautonomy.com/jiangmenhenbertsewingtechnology.cn
Henbert is a manufactory which specializes in providing professional equipments for waterproof treatment and relates hot air waterproof adhesive tapes. With many years of experience in this field,... مزید پڑھیں »
- پیکجنگ مشینری | سلائی مشینوں اور لوازمات - صنعتی
- Jianghai
- چین
supplyautonomy.com/taidragonmachineryco.tw
TAI DRAGON MACHINERY CO., LTD. was establish in 1977, specializing in the manufacture of High-Speed Horizontal Wrapping Machines.The machinery we make is based on the goal of pursuing high quality... مزید پڑھیں »
- مشینری ریپنگ اور بیرونی-ریپنگ | پیکجنگ مشینری
- Taizhong
- تائیوان
supplyautonomy.com/sicogaz.fr
- نمائش کھڑا ہے (باڑے / رینٹل) | نمائش ہال (باڑے / رینٹل) | کانفرنس کے کمرے (باڑے / رینٹل) | تجارتی میلے کے منتظمین، کپڑے،...
- Puteaux
- فرانس