Резултати од пребарувањето за: Машини за пакување

Најде 7631 компании

Категории поврзани со


supplyautonomy.com/gayatriengineers2.in
GAYATRI ENGINEERS, MUMBAI is the only in india manufactures complete range of Fabric Inspection System, under one roof with all world network. Mr. Vinod Panchal, who is the owner of GAYATRI, has a... Прочитај повеќе »
  • Машини за изработка на доработка на текстилни материјали | Машини за пакување...
  • Thane
  • Индија
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... Прочитај повеќе »
  • Прехранбената индустрија постројки и опрема НСВ | Машини за пакување...
  • Baoding
  • Кина
supplyautonomy.com/zhejianguniversalpackingmachineryfactory.cn
Zhejiang Universal Packing Machinery Factory has been specialized in manufacturing professional machinery for producing polypropylene (PP) spunbond non-woven fabrics and SMS composite nonwoven and... Прочитај повеќе »
  • Машини за шиење | Машини за пакување
  • Wenzhou
  • Кина
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... Прочитај повеќе »
  • Други фармацевтски машини | Машини за пакување
  • Ruian
  • Кина
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are: Pure/Mineral water production lines Carbonated drink production lines; Fruit juice production lines Tea drink production lines Soy milk and protein drink production... Прочитај повеќе »
  • Чиста вода | Машини за пакување
  • Suzhou
  • Кина
supplyautonomy.com/sunwayinternational.cn
Guangzhou Sunway Industrial Co., Ltd. is specialized in manufacturing packaging machinery and daily chemical machinery, such as: 1. Tube Production Lines 2. Toothpaste Production Lines 3.... Прочитај повеќе »
  • Цевки фитинзи | Прехранбената индустрија постројки и опрема НСВ | Подвижни ленти | Машини за пакување...
  • Guangzhou
  • Кина
supplyautonomy.com/kunshanfuriprecisionmachineryco.cn
With European technology, we manufacture adhesive tape coating machine, cutting machine, rewinding machine, bopp tape slitting machine, etc.The products have passed ISO 9001:2000 Certification CE... Прочитај повеќе »
  • Градители "алатки | Други текстилни машини | Ракуваат машини за мелење на металите | Машини за пакување...
  • Kunshan
  • Кина
supplyautonomy.com/hebeipingancartonpackagingmachineryco.cn
Hebei Pingan Carton Packaging Machinery Co., Ltd. was founded in 1990. We are a large enterprise specialized in manufacturing of the carton packaging machinery. Our company is conveniently located... Прочитај повеќе »
  • Машини за пакување | Други материјали за пакување
  • Cangzhou
  • Кина
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people. Our... Прочитај повеќе »
  • Прехранбената индустрија постројки и опрема НСВ | Укине маси | Машини за пакување | Стејплс, жица...
  • Shijiazhuang
  • Кина
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... Прочитај повеќе »
  • Машини за пакување | Опрема за дървообработка
  • Guangzhou
  • Кина
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... Прочитај повеќе »
  • Опрема за заварување | Пластични заварувачи | Машини за пакување | Јајце пепелниците...
  • Guangzhou
  • Кина
supplyautonomy.com/earthpolystrappolymersindustries.in
Partner of the earth Polymers Industries field of packing material since the year of 2003. Earth Polymers Industries is a basically sister concert company of Earth Poly Strap based at rajkot which... Прочитај повеќе »
  • Лепила и лента | Машини за пакување | Други материјали за пакување | Мускулест...
  • Rajkot
  • Индија
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... Прочитај повеќе »
  • Машини за пакување | Фармацевтски пакување машина | Други материјали за пакување...
  • Ahmedabad
  • Индија
supplyautonomy.com/automaticsystems.in
Company Outline AUTOMATIC SYSTEMS is dedicated to provide extensive facilities in designing, engineering, inspecting, manufacturing, installation and commissioning, maintenance. Additionally it s... Прочитај повеќе »
  • Машини за симнување на жица и обработка на метали за жица | Машини за пакување...
  • Jalgaon
  • Индија
supplyautonomy.com/acmesalecorporation.in
If you are interested in any of our products, you could contact us at 0091-9356001102 ( Mr. Anil Garg ) or 0091-9876577991 ( Mr.Keshav Garg ). Introduction :- Acme Sales Corporation was... Прочитај повеќе »
  • Пластика сечење машини | Машини за пакување
  • Amritsar
  • Индија
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... Прочитај повеќе »
  • Завиткување и пакување - машини и опрема | Тапани, Кофи и буриња
  • Aylesbury
  • Велика Британија
supplyautonomy.com/shreejipharmatech.in
About Us Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... Прочитај повеќе »
  • Други текстилни машини | Машини за пакување
  • Ahmedabad
  • Индија
supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... Прочитај повеќе »
  • Принтери, фотографија | Маркери | Лепила и лента | Машини за пакување...
  • Kochi
  • Индија
supplyautonomy.com/hipackfillmachinespvt.in
Zulfikar Saifi, who laid foundation stone of his company in 1993, now running with the name of Hi-Pack And Fill Machines Pvt. Ltd., with the strong base of more than 200 satisfied customers with... Прочитај повеќе »
  • Машини за пакување
  • Faridabad
  • Индија
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers, First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... Прочитај повеќе »
  • Чипка машини | Машини за пакување
  • Ahmedabad
  • Индија
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... Прочитај повеќе »
  • Капсула пополнување машина | Машини за пакување
  • Mumbai
  • Индија
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... Прочитај повеќе »
  • Машини за пакување | Мускулест
  • New Delhi
  • Индија
supplyautonomy.com/monarchappliances.in
MONARCH APPLIANCES IS A MARKETING UNIT OF PACKAGING MACHINERY, LEBELING MACHINE PACKAGING MATERIAL SINCE 1990. AFTER GRAND SUCCESS IN MARKETING OF PACKAGING MACHINERY, WE ENTERED INTO... Прочитај повеќе »
  • Влажни избрише машини | Машини за пакување
  • Rajkot
  • Индија
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group! Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... Прочитај повеќе »
  • Ориз торба | Машини за пакување | Мускулест
  • Ahmedabad
  • Индија
supplyautonomy.com/problend.bg
We offer : -constructing, manufacture, service and innovative production solutions for packaging equipment -constructing, manufacture, service and innovation of non-standard equipment on... Прочитај повеќе »
  • Генералниот Механички Делови берза | Завиткување и пакување - машини и опрема...
  • Shumen
  • Бугарија
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... Прочитај повеќе »
  • Завиткување и пакување - машини и опрема | Машини за пакување
  • Reggiolo
  • Италија
supplyautonomy.com/dolzanimpiantisrl.it
Vertical packing machines, by weight / volume, with 4 welds, Doypack, vacuum, multi-track and semi-automatic for the food processing, pastry making, chemicals, pharmaceuticals and mechanical sectors.
  • Завиткување и пакување - машини и опрема | Прехранбена индустрија, разни постапки - машини и опрема...
  • Galliera Veneta
  • Италија
supplyautonomy.com/jiangmenhenbertsewingtechnology.cn
Henbert is a manufactory which specializes in providing professional equipments for waterproof treatment and relates hot air waterproof adhesive tapes. With many years of experience in this field,... Прочитај повеќе »
  • Машини за пакување | Фабрички машини за шиење и додатоци
  • Jianghai
  • Кина
supplyautonomy.com/taidragonmachineryco.tw
TAI DRAGON MACHINERY CO., LTD. was establish in 1977, specializing in the manufacture of High-Speed Horizontal Wrapping Machines.The machinery we make is based on the goal of pursuing high quality... Прочитај повеќе »
  • Обвини или дополнително обвини - машини | Машини за пакување
  • Taizhong
  • Тајван
supplyautonomy.com/sicogaz.fr
  • Витрините (вработи / изнајмување) | Изложбените сали (вработи / изнајмување) | -Конференција соби (вработи / за изнајмув...
  • Puteaux
  • Франција