Результати пошуку для: Пакувальні машини
Знайдено 7631 компаніїПов'язані категорії
supplyautonomy.com/gayatriengineers2.in
GAYATRI ENGINEERS, MUMBAI is the only in india manufactures complete range of Fabric Inspection System, under one roof with all world network. Mr. Vinod Panchal, who is the owner of GAYATRI, has a... Детальніше »
- Машини для виготовлення оздоблення текстилю | Пакувальне обладнання...
- Thane
- Індія
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... Детальніше »
- Установки й устаткування для харчової промисловості не зазначені в іншому місці | Пакувальне обладнання...
- Baoding
- Китай
supplyautonomy.com/zhejianguniversalpackingmachineryfactory.cn
Zhejiang Universal Packing Machinery Factory has been specialized in manufacturing professional machinery for producing polypropylene (PP) spunbond non-woven fabrics and SMS composite nonwoven and... Детальніше »
- Швейні машини | Пакувальне обладнання
- Wenzhou
- Китай
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... Детальніше »
- Інші машини виготовлення ліків | Пакувальне обладнання
- Ruian
- Китай
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are:
Pure/Mineral water production lines
Carbonated drink production lines;
Fruit juice production lines
Tea drink production lines
Soy milk and protein drink production... Детальніше »
- Чисто вода | Пакувальне обладнання
- Suzhou
- Китай
supplyautonomy.com/sunwayinternational.cn
Guangzhou Sunway Industrial Co., Ltd. is specialized in manufacturing packaging machinery and daily chemical machinery, such as:
1. Tube Production Lines
2. Toothpaste Production Lines
3.... Детальніше »
- Трубопровідна арматура | Установки й устаткування для харчової промисловості не зазначені в іншому місці | Конвеєр | Пак...
- Guangzhou
- Китай
supplyautonomy.com/kunshanfuriprecisionmachineryco.cn
With European technology, we manufacture adhesive tape coating machine, cutting machine, rewinding machine, bopp tape slitting machine, etc.The products have passed ISO 9001:2000 Certification CE... Детальніше »
- Інструменти для будівельних робіт | Інші швейні машини | Верстати для фрезерування металу | Пакувальне обладнання...
- Kunshan
- Китай
supplyautonomy.com/hebeipingancartonpackagingmachineryco.cn
Hebei Pingan Carton Packaging Machinery Co., Ltd. was founded in 1990. We are a large enterprise specialized in manufacturing of the carton packaging machinery. Our company is conveniently located... Детальніше »
- Пакувальне обладнання | Інші пакувальні матеріали
- Cangzhou
- Китай
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people.
Our... Детальніше »
- Установки й устаткування для харчової промисловості не зазначені в іншому місці | Ліфт | Пакувальне обладнання | Скоби з...
- Shijiazhuang
- Китай
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... Детальніше »
- Пакувальне обладнання | Деревообробне обладнання
- Guangzhou
- Китай
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... Детальніше »
- Зварювання | Пластикові зварювальні пальники | Пакувальне обладнання | Підноси яйця...
- Guangzhou
- Китай
supplyautonomy.com/earthpolystrappolymersindustries.in
Partner of the earth Polymers Industries field of packing material since the year of 2003. Earth Polymers Industries is a basically sister concert company of Earth Poly Strap based at rajkot which... Детальніше »
- Клеї й стрічки | Пакувальне обладнання | Інші пакувальні матеріали | Ремінь...
- Rajkot
- Індія
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... Детальніше »
- Пакувальне обладнання | Маішна упаковки ліки | Інші пакувальні матеріали...
- Ahmedabad
- Індія
supplyautonomy.com/automaticsystems.in
Company Outline
AUTOMATIC SYSTEMS is dedicated to provide extensive facilities in designing, engineering, inspecting, manufacturing, installation and commissioning, maintenance. Additionally it s... Детальніше »
- Обладнання для волочіння дроту, прутка | Пакувальне обладнання
- Jalgaon
- Індія
supplyautonomy.com/acmesalecorporation.in
If you are interested in any of our products, you could contact us at 0091-9356001102 ( Mr. Anil Garg ) or 0091-9876577991 ( Mr.Keshav Garg ).
Introduction :-
Acme Sales Corporation was... Детальніше »
- Пластикові різальні машини | Пакувальне обладнання
- Amritsar
- Індія
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... Детальніше »
- Упаковка та пакувальні матеріали - техніка та обладнання | Барабани, відра та баки...
- Aylesbury
- Велика Британія
supplyautonomy.com/shreejipharmatech.in
About Us
Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... Детальніше »
- Інші текстильне обладнання | Пакувальне обладнання
- Ahmedabad
- Індія
supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... Детальніше »
- Принтери комп'ютерні для друку фотографій | Маркери | Клеї й стрічки | Пакувальне обладнання...
- Kochi
- Індія
supplyautonomy.com/hipackfillmachinespvt.in
Zulfikar Saifi, who laid foundation stone of his company in 1993, now running with the name of Hi-Pack And Fill Machines Pvt. Ltd., with the strong base of more than 200 satisfied customers with... Детальніше »
- Пакувальне обладнання
- Faridabad
- Індія
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers,
First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... Детальніше »
- Машини для шнурків | Пакувальне обладнання
- Ahmedabad
- Індія
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... Детальніше »
- Машина заповненої капусули | Пакувальне обладнання
- Mumbai
- Індія
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... Детальніше »
- Пакувальне обладнання | Ремінь
- New Delhi
- Індія
supplyautonomy.com/monarchappliances.in
MONARCH APPLIANCES IS A MARKETING UNIT OF PACKAGING MACHINERY, LEBELING MACHINE PACKAGING MATERIAL SINCE 1990.
AFTER GRAND SUCCESS IN MARKETING OF PACKAGING MACHINERY, WE ENTERED INTO... Детальніше »
- Машина виготовлення вологої серветки | Пакувальне обладнання
- Rajkot
- Індія
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group!
Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... Детальніше »
- Мішок для рису | Пакувальне обладнання | Ремінь
- Ahmedabad
- Індія
supplyautonomy.com/problend.bg
We offer :
-constructing, manufacture, service and innovative production solutions for packaging equipment
-constructing, manufacture, service and innovation of non-standard equipment on... Детальніше »
- Запаси загальноприйнятих елементи механізму | Упаковка та пакувальні матеріали - техніка та обладнання...
- Shumen
- Болгарія
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... Детальніше »
- Упаковка та пакувальні матеріали - техніка та обладнання | Пакувальне обладнання...
- Reggiolo
- Італія
supplyautonomy.com/dolzanimpiantisrl.it
Vertical packing machines, by weight / volume, with 4 welds, Doypack, vacuum, multi-track and semi-automatic for the food processing, pastry making, chemicals, pharmaceuticals and mechanical sectors.
- Упаковка та пакувальні матеріали - техніка та обладнання | Харчова промисловість - техніка та обладнання...
- Galliera Veneta
- Італія
supplyautonomy.com/jiangmenhenbertsewingtechnology.cn
Henbert is a manufactory which specializes in providing professional equipments for waterproof treatment and relates hot air waterproof adhesive tapes. With many years of experience in this field,... Детальніше »
- Пакувальне обладнання | Швейні машини та приладдя (промислові)
- Jianghai
- Китай
supplyautonomy.com/taidragonmachineryco.tw
TAI DRAGON MACHINERY CO., LTD. was establish in 1977, specializing in the manufacture of High-Speed Horizontal Wrapping Machines.The machinery we make is based on the goal of pursuing high quality... Детальніше »
- Загортання машини | Пакувальне обладнання
- Taizhong
- Тайвань
supplyautonomy.com/sicogaz.fr
- Послуги прокату і оренди виставкових, демонстраційних стендів | Послуги прокату і оренди виставкових, демонстраційних за...
- Puteaux
- Франція