Loading...
Mga Resulta ng Paghahanap para sa: Packaging machine
Nahanap 7630 kumpanyaKaugnay na mga kategorya
supplyautonomy.com/gayatriengineers2.in
GAYATRI ENGINEERS, MUMBAI is the only in india manufactures complete range of Fabric Inspection System, under one roof with all world network. Mr. Vinod Panchal, who is the owner of GAYATRI, has a... Basahin Higit pang mga »
- Textile-Tinatapos makinarya | Packaging makinarya
- Thane
- India
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... Basahin Higit pang mga »
- Pagkain industriya halaman at equipment Nes | Packaging makinarya
- Baoding
- China
supplyautonomy.com/zhejianguniversalpackingmachineryfactory.cn
Zhejiang Universal Packing Machinery Factory has been specialized in manufacturing professional machinery for producing polypropylene (PP) spunbond non-woven fabrics and SMS composite nonwoven and... Basahin Higit pang mga »
- Pananahi machine | Packaging makinarya
- Wenzhou
- China
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... Basahin Higit pang mga »
- Iba pang mga pharmaceutical makinarya | Packaging makinarya
- Ruian
- China
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are:
Pure/Mineral water production lines
Carbonated drink production lines;
Fruit juice production lines
Tea drink production lines
Soy milk and protein drink production... Basahin Higit pang mga »
- Purong tubig | Packaging makinarya
- Suzhou
- China
supplyautonomy.com/sunwayinternational.cn
Guangzhou Sunway Industrial Co., Ltd. is specialized in manufacturing packaging machinery and daily chemical machinery, such as:
1. Tube Production Lines
2. Toothpaste Production Lines
3.... Basahin Higit pang mga »
- pipe fitting | Pagkain industriya halaman at equipment Nes | Conveyors | Packaging makinarya
- Guangzhou
- China
supplyautonomy.com/kunshanfuriprecisionmachineryco.cn
With European technology, we manufacture adhesive tape coating machine, cutting machine, rewinding machine, bopp tape slitting machine, etc.The products have passed ISO 9001:2000 Certification CE... Basahin Higit pang mga »
- Builders 'tool | Iba pang mga damit makinarya | Machine tool para sa nagpapaikut-ikot metal | Packaging makinarya
- Kunshan
- China
supplyautonomy.com/hebeipingancartonpackagingmachineryco.cn
Hebei Pingan Carton Packaging Machinery Co., Ltd. was founded in 1990. We are a large enterprise specialized in manufacturing of the carton packaging machinery. Our company is conveniently located... Basahin Higit pang mga »
- Packaging makinarya | Iba pang mga packaging mga materyales
- Cangzhou
- China
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people.
Our... Basahin Higit pang mga »
- Pagkain industriya halaman at equipment Nes | Iangat mga talahanayan | Packaging makinarya | Staples, wire
- Shijiazhuang
- China
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... Basahin Higit pang mga »
- Packaging makinarya | Woodworking kagamitan
- Guangzhou
- China
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... Basahin Higit pang mga »
- hinang kagamitan | Plastic welders | Packaging makinarya | Egg trays
- Guangzhou
- China
supplyautonomy.com/earthpolystrappolymersindustries.in
Partner of the earth Polymers Industries field of packing material since the year of 2003. Earth Polymers Industries is a basically sister concert company of Earth Poly Strap based at rajkot which... Basahin Higit pang mga »
- Pandikit at tape | Packaging makinarya | Iba pang mga packaging mga materyales | Matangkad at malusog
- Rajkot
- India
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... Basahin Higit pang mga »
- Packaging makinarya | Pharmaceutical packaging machine | Iba pang mga packaging mga materyales
- Ahmedabad
- India
supplyautonomy.com/automaticsystems.in
Company Outline
AUTOMATIC SYSTEMS is dedicated to provide extensive facilities in designing, engineering, inspecting, manufacturing, installation and commissioning, maintenance. Additionally it s... Basahin Higit pang mga »
- Wire pagguhit at wire pamalo pagtatrabaho machine | Packaging makinarya
- Jalgaon
- India
supplyautonomy.com/acmesalecorporation.in
If you are interested in any of our products, you could contact us at 0091-9356001102 ( Mr. Anil Garg ) or 0091-9876577991 ( Mr.Keshav Garg ).
Introduction :-
Acme Sales Corporation was... Basahin Higit pang mga »
- Plastic paggupit makinarya | Packaging makinarya
- Amritsar
- India
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... Basahin Higit pang mga »
- Packing at packaging - makinarya at kagamitan | Drums, pails at barrels
- Aylesbury
- United Kingdom
supplyautonomy.com/shreejipharmatech.in
About Us
Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... Basahin Higit pang mga »
- Iba pang mga hinabi makinarya | Packaging makinarya
- Ahmedabad
- India
supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... Basahin Higit pang mga »
- Mga Printer, kunan ng larawan | Marker Panulat | Pandikit at tape | Packaging makinarya
- Kochi
- India
supplyautonomy.com/hipackfillmachinespvt.in
Zulfikar Saifi, who laid foundation stone of his company in 1993, now running with the name of Hi-Pack And Fill Machines Pvt. Ltd., with the strong base of more than 200 satisfied customers with... Basahin Higit pang mga »
- Packaging makinarya
- Faridabad
- India
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers,
First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... Basahin Higit pang mga »
- Puntas machine | Packaging makinarya
- Ahmedabad
- India
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... Basahin Higit pang mga »
- Capsule pagpuno machine | Packaging makinarya
- Mumbai
- India
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... Basahin Higit pang mga »
- Packaging makinarya | Matangkad at malusog
- New Delhi
- India
supplyautonomy.com/monarchappliances.in
MONARCH APPLIANCES IS A MARKETING UNIT OF PACKAGING MACHINERY, LEBELING MACHINE PACKAGING MATERIAL SINCE 1990.
AFTER GRAND SUCCESS IN MARKETING OF PACKAGING MACHINERY, WE ENTERED INTO... Basahin Higit pang mga »
- Basa punasan paggawa ng makinarya | Packaging makinarya
- Rajkot
- India
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group!
Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... Basahin Higit pang mga »
- Kanin bag | Packaging makinarya | Matangkad at malusog
- Ahmedabad
- India
supplyautonomy.com/problend.bg
We offer :
-constructing, manufacture, service and innovative production solutions for packaging equipment
-constructing, manufacture, service and innovation of non-standard equipment on... Basahin Higit pang mga »
- Pangkalahatang mekanikal mga bahagi stock | Packing at packaging - makinarya at kagamitan
- Shumen
- Bulgaria
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... Basahin Higit pang mga »
- Packing at packaging - makinarya at kagamitan | Packaging makinarya
- Reggiolo
- Italya
supplyautonomy.com/dolzanimpiantisrl.it
Vertical packing machines, by weight / volume, with 4 welds, Doypack, vacuum, multi-track and semi-automatic for the food processing, pastry making, chemicals, pharmaceuticals and mechanical sectors.
- Packing at packaging - makinarya at kagamitan | Pagkain industriya - makinarya at kagamitan
- Galliera Veneta
- Italya
supplyautonomy.com/jiangmenhenbertsewingtechnology.cn
Henbert is a manufactory which specializes in providing professional equipments for waterproof treatment and relates hot air waterproof adhesive tapes. With many years of experience in this field,... Basahin Higit pang mga »
- Packaging makinarya | Pananahi machine at accessories - pang-industriya
- Jianghai
- China
supplyautonomy.com/taidragonmachineryco.tw
TAI DRAGON MACHINERY CO., LTD. was establish in 1977, specializing in the manufacture of High-Speed Horizontal Wrapping Machines.The machinery we make is based on the goal of pursuing high quality... Basahin Higit pang mga »
- Pambalot at panlabas na-wrapping makinarya | Packaging makinarya
- Taizhong
- Taiwan
supplyautonomy.com/sicogaz.fr
- Exhibition nakatayo (hire / rental) | Exhibition halls (hire / rental) | Conference room (hire / rental) | Trade fair...
- Puteaux
- France