Loading...
Търси резултати за: Машини за пакетиране
Намерени 7631 фирмиСвързани категории
supplyautonomy.com/gayatriengineers2.in
GAYATRI ENGINEERS, MUMBAI is the only in india manufactures complete range of Fabric Inspection System, under one roof with all world network. Mr. Vinod Panchal, who is the owner of GAYATRI, has a... Прочетете още »
- Машини за извършване на довършителни работи по текстилни материали | Опаковъчни машини...
- Thane
- Индия
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... Прочетете още »
- Инсталации и оборудване за хранително-вкусовата промишленост не другаде | Опаковъчни машини...
- Baoding
- Китай
supplyautonomy.com/zhejianguniversalpackingmachineryfactory.cn
Zhejiang Universal Packing Machinery Factory has been specialized in manufacturing professional machinery for producing polypropylene (PP) spunbond non-woven fabrics and SMS composite nonwoven and... Прочетете още »
- Шевни машини | Опаковъчни машини
- Wenzhou
- Китай
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... Прочетете още »
- Други лекарства, машини за производство | Опаковъчни машини
- Ruian
- Китай
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are:
Pure/Mineral water production lines
Carbonated drink production lines;
Fruit juice production lines
Tea drink production lines
Soy milk and protein drink production... Прочетете още »
- Бистра вода | Опаковъчни машини
- Suzhou
- Китай
supplyautonomy.com/sunwayinternational.cn
Guangzhou Sunway Industrial Co., Ltd. is specialized in manufacturing packaging machinery and daily chemical machinery, such as:
1. Tube Production Lines
2. Toothpaste Production Lines
3.... Прочетете още »
- Тръбни фитинги | Инсталации и оборудване за хранително-вкусовата промишленост не другаде | Транспортни ленти | Опаковъчн...
- Guangzhou
- Китай
supplyautonomy.com/kunshanfuriprecisionmachineryco.cn
With European technology, we manufacture adhesive tape coating machine, cutting machine, rewinding machine, bopp tape slitting machine, etc.The products have passed ISO 9001:2000 Certification CE... Прочетете още »
- Инструменти към строежите | Други шевни машини | Обработващи машини за фрезоване на металите | Опаковъчни машини...
- Kunshan
- Китай
supplyautonomy.com/hebeipingancartonpackagingmachineryco.cn
Hebei Pingan Carton Packaging Machinery Co., Ltd. was founded in 1990. We are a large enterprise specialized in manufacturing of the carton packaging machinery. Our company is conveniently located... Прочетете още »
- Опаковъчни машини | Други опаковъчни материали
- Cangzhou
- Китай
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people.
Our... Прочетете още »
- Инсталации и оборудване за хранително-вкусовата промишленост не другаде | Асансьор | Опаковъчни машини | Staples тел...
- Shijiazhuang
- Китай
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... Прочетете още »
- Опаковъчни машини | Оборудване за дървообработка
- Guangzhou
- Китай
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... Прочетете още »
- Оборудване за заваряване | Пластмасови заваръчни горелки | Опаковъчни машини | Улуци за яйца...
- Guangzhou
- Китай
supplyautonomy.com/earthpolystrappolymersindustries.in
Partner of the earth Polymers Industries field of packing material since the year of 2003. Earth Polymers Industries is a basically sister concert company of Earth Poly Strap based at rajkot which... Прочетете още »
- Лепила и ленти | Опаковъчни машини | Други опаковъчни материали | Колан...
- Rajkot
- Индия
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... Прочетете още »
- Опаковъчни машини | Maishna опаковки лекарства | Други опаковъчни материали...
- Ahmedabad
- Индия
supplyautonomy.com/automaticsystems.in
Company Outline
AUTOMATIC SYSTEMS is dedicated to provide extensive facilities in designing, engineering, inspecting, manufacturing, installation and commissioning, maintenance. Additionally it s... Прочетете още »
- Машини за изтегляне на тел и обработка на металите за тел | Опаковъчни машини...
- Jalgaon
- Индия
supplyautonomy.com/acmesalecorporation.in
If you are interested in any of our products, you could contact us at 0091-9356001102 ( Mr. Anil Garg ) or 0091-9876577991 ( Mr.Keshav Garg ).
Introduction :-
Acme Sales Corporation was... Прочетете още »
- Пластмасови машини за рязане | Опаковъчни машини
- Amritsar
- Индия
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... Прочетете още »
- Амбалаж и опаковане - машини и техника | Барабани, кофи и вани
- Aylesbury
- Обединено кралство
supplyautonomy.com/shreejipharmatech.in
About Us
Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... Прочетете още »
- Други Текстилна техника | Опаковъчни машини
- Ahmedabad
- Индия
supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... Прочетете още »
- Компютърни принтери за печат на снимки | Маркери | Лепила и ленти | Опаковъчни машини...
- Kochi
- Индия
supplyautonomy.com/hipackfillmachinespvt.in
Zulfikar Saifi, who laid foundation stone of his company in 1993, now running with the name of Hi-Pack And Fill Machines Pvt. Ltd., with the strong base of more than 200 satisfied customers with... Прочетете още »
- Опаковъчни машини
- Faridabad
- Индия
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers,
First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... Прочетете още »
- Машини за дантели | Опаковъчни машини
- Ahmedabad
- Индия
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... Прочетете още »
- Устройството е изпълнен kapusuly | Опаковъчни машини
- Mumbai
- Индия
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... Прочетете още »
- Опаковъчни машини | Колан
- New Delhi
- Индия
supplyautonomy.com/monarchappliances.in
MONARCH APPLIANCES IS A MARKETING UNIT OF PACKAGING MACHINERY, LEBELING MACHINE PACKAGING MATERIAL SINCE 1990.
AFTER GRAND SUCCESS IN MARKETING OF PACKAGING MACHINERY, WE ENTERED INTO... Прочетете още »
- Колата производствени мокри кърпички | Опаковъчни машини
- Rajkot
- Индия
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group!
Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... Прочетете още »
- Плик с ориз | Опаковъчни машини | Колан
- Ahmedabad
- Индия
supplyautonomy.com/problend.bg
We offer :
-constructing, manufacture, service and innovative production solutions for packaging equipment
-constructing, manufacture, service and innovation of non-standard equipment on... Прочетете още »
- Складовите общоприети елементи на механизма | Амбалаж и опаковане - машини и техника...
- Shumen
- България
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... Прочетете още »
- Амбалаж и опаковане - машини и техника | Опаковъчни машини
- Reggiolo
- Италия
supplyautonomy.com/dolzanimpiantisrl.it
Vertical packing machines, by weight / volume, with 4 welds, Doypack, vacuum, multi-track and semi-automatic for the food processing, pastry making, chemicals, pharmaceuticals and mechanical sectors.
- Амбалаж и опаковане - машини и техника | Хранителна промишленост, разни производства - машини и техника...
- Galliera Veneta
- Италия
supplyautonomy.com/jiangmenhenbertsewingtechnology.cn
Henbert is a manufactory which specializes in providing professional equipments for waterproof treatment and relates hot air waterproof adhesive tapes. With many years of experience in this field,... Прочетете още »
- Опаковъчни машини | Фабрични шевни машини и аксесоари
- Jianghai
- Китай
supplyautonomy.com/taidragonmachineryco.tw
TAI DRAGON MACHINERY CO., LTD. was establish in 1977, specializing in the manufacture of High-Speed Horizontal Wrapping Machines.The machinery we make is based on the goal of pursuing high quality... Прочетете още »
- Обвиване или допълнително обвиване - машини | Опаковъчни машини
- Taizhong
- Тайван